9uen

Cryo-EM structure of coccolithophore photosystem I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light harvesting protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1FED1_EMIHU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–201； UniProt 1–201

Light harvesting protein

OrganismNot specified

UniProt A0A6V2SE28

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6V2SE28_EMIHU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–208； UniProt 26–233

Light harvesting protein

OrganismNot specified

UniProt A0A7S3TXG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S3TXG5_EMIHU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–217； UniProt 11–227

Light harvesting protein

OrganismNot specified

UniProt R1DWS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1DWS2_EMIHU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–239； UniProt 1–239

Light harvesting protein

OrganismNot specified

UniProt R1DY94

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1DY94_EMIHU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–198； UniProt 1–198

Light harvesting protein

OrganismNot specified

UniProt A0A7S3WIW7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S3WIW7_EMIHU
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–199； UniProt 12–210

Light harvesting protein

OrganismNot specified

UniProt A0A7S3TFW5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S3TFW5_EMIHU
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–196； UniProt 14–209

Light harvesting protein

OrganismNot specified

UniProt A0A7S3WZA0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S3WZA0_EMIHU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–208； UniProt 12–219

Light harvesting protein

OrganismNot specified

UniProt R1B3D6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1B3D6_EMIHU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–204； UniProt 1–204

Light harvesting protein

OrganismNot specified

UniProt R1BTM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1BTM8_EMIHU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–224； UniProt 1–224 Author chain P； PDBConstruct 1–224； UniProt 1–224 Author chain W； PDBConstruct 1–224； UniProt 1–224

Light harvesting protein

OrganismNot specified

UniProt R1DCN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1DCN2_EMIHU
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–210； UniProt 1–210 Author chain R； PDBConstruct 1–210； UniProt 1–210 Author chain T； PDBConstruct 1–210； UniProt 1–210

Light harvesting protein

OrganismNot specified

UniProt R1ED82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1ED82_EMIHU
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain U； PDBConstruct 1–198； UniProt 1–198

LEFP

OrganismNot specified

UniProt R1DLA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1DLA7_EMIHU
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain V； PDBConstruct 1–123； UniProt 1–123

Light harvesting protein

OrganismNot specified

UniProt R1CMT6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1CMT6_EMIHU
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain X； PDBConstruct 1–253； UniProt 1–253

Light harvesting protein

OrganismNot specified

UniProt R1FP66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1FP66_EMIHU
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Y； PDBConstruct 1–244； UniProt 1–244

Light harvesting protein

OrganismNot specified

UniProt R1CV07

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1CV07_EMIHU
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Z； PDBConstruct 1–254； UniProt 1–254

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt Q4G3F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_EMIHU
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain a； PDBConstruct 1–752； UniProt 1–752

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt Q4G3F5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_EMIHU
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain b； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q4G3C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_EMIHU
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt Q4G369

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4G369_EMIHU
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain d； PDBConstruct 1–142； UniProt 1–142

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt R1EZZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1EZZ6_EMIHU
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain e； PDBConstruct 1–131； UniProt 1–131

Photosystem I reaction center subunit III

OrganismNot specified

UniProt Q4G3B9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4G3B9_EMIHU
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain f； PDBConstruct 1–184； UniProt 1–184

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt Q4G373

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_EMIHU
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain i； PDBConstruct 1–36； UniProt 1–36

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt Q4G3B8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_EMIHU
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain j； PDBConstruct 1–40； UniProt 1–40

PSI-K

OrganismNot specified

UniProt A0A7S3X4W4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S3X4W4_EMIHU
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain k； PDBConstruct 1–112； UniProt 34–145

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt Q4G3B5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_EMIHU
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain l； PDBConstruct 1–145； UniProt 1–145

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt Q4G371

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_EMIHU
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain m； PDBConstruct 1–30； UniProt 1–30

Light harvesting protein

OrganismNot specified

UniProt R1EIA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1EIA6_EMIHU
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain p； PDBConstruct 1–255； UniProt 1–255 Author chain u； PDBConstruct 1–255； UniProt 1–255 Author chain x； PDBConstruct 1–255； UniProt 1–255

Light harvesting protein

OrganismNot specified

UniProt R1DAV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1DAV6_EMIHU
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain q； PDBConstruct 1–268； UniProt 1–268 Author chain v； PDBConstruct 1–268； UniProt 1–268

Light harvesting protein

OrganismNot specified

UniProt R1CGG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 1 （R1EB65） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1CGG7_EMIHU
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain t； PDBConstruct 1–260； UniProt 1–260 Author chain w； PDBConstruct 1–260； UniProt 1–260 Author chain y； PDBConstruct 1–260； UniProt 1–260

Light harvesting protein

OrganismNot specified

UniProt R1EB65

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Light harvesting protein × 1 （R1FED1） EFCPI-1 × 1 Light harvesting protein × 1 （A0A6V2SE28） EFCPI-6 × 1 Light harvesting protein × 1 （A0A7S3TXG5） Light harvesting protein × 1 （R1DWS2） Light harvesting protein × 1 （R1DY94） Light harvesting protein × 1 （A0A7S3WIW7） Light harvesting protein × 1 （A0A7S3TFW5） Light harvesting protein × 1 （A0A7S3WZA0） Light harvesting protein × 1 （R1B3D6） EFCPI-12 × 1 Light harvesting protein × 3 （R1BTM8） EFCPI-17 × 1 Light harvesting protein × 3 （R1DCN2） EFCPI-18 × 1 EFCPI-22 × 1 Light harvesting protein × 1 （R1ED82） LEFP × 1 （R1DLA7） Light harvesting protein × 1 （R1CMT6） Light harvesting protein × 1 （R1FP66） Light harvesting protein × 1 （R1CV07） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （Q4G3F6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （Q4G3F5） Photosystem I iron-sulfur center × 1 （Q4G3C1） Photosystem I reaction center subunit II × 1 （Q4G369） Photosystem I reaction center subunit IV × 1 （R1EZZ6） Photosystem I reaction center subunit III × 1 （Q4G3B9） Photosystem I reaction center subunit VIII × 1 （Q4G373） Photosystem I reaction center subunit IX × 1 （Q4G3B8） PSI-K × 1 （A0A7S3X4W4） Photosystem I reaction center subunit XI × 1 （Q4G3B5） Photosystem I reaction center subunit XII × 1 （Q4G371） EFCPI-30 × 1 Light harvesting protein × 3 （R1EIA6） Light harvesting protein × 2 （R1DAV6） PsaR × 1 Light harvesting protein × 3 （R1CGG7） CHLOROPHYLL A × 387 Chlorophyll c2 × 121 (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol × 73 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 ;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ; × 109 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 6 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ; × 42 ;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ; × 3 BETA-CAROTENE × 20 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1EB65_EMIHU
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain z； PDBConstruct 1–257； UniProt 1–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uen
Deposition date deposition_date	2025-04-08
Structure title title	Cryo-EM structure of coccolithophore photosystem I
Keywords keywords	Coccolithophore, Photosystem I, evolution, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uen__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uen__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uen__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	98.53 Å
Rg (electron density)	98.43 Å
Total Rg	97.91 Å
Atom count	110078
Residues	9159
Excluded volume	2051000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uen__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (52)

Entity 1 Entity 1 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21992.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	110086

MVVGMPSTVVSRSSGVAMAISKPSNAMPFLTAPPCQSSKLPGAETGFDPLYLSEFIDIKWAREAELKHGRICMLATVGYIMQEFFSLPGYPGYTPNPIEAVSSTPPEALAQIVLVLSIIEFNSNKDKWTMDTMFTDPAREPGNLGFDPLKFGENKETRERLAMAELKNGRLAMIAFSGMIHQTFVTGKPLFASLNDIFSSP

Entity 2 Entity 2 polymer

Description description	EFCPI-1
Molecular weight formula_weight	22929.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MFPVSVASFALAPAVRPVVTTPVVRAPAPLAVAPAAAGFEKGMSQFAADYPWLAKYGFGPTVKAERWNGRHAMFGWLAILGTGVAKSHGWLPSGDVALTYNEWGGLAQQGFNTYITNERAIIMIAHVHALAVSAAAAFGPQVLGDSLTLLDGEKDEDPYGLFVPLKGTFGLTPAAEMANGRMAMMGIIAVVLTSAISGKDILEVVDIGTGGNLLTHPMF

Entity 3 Entity 3 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	22043.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MLSLVGSPLSLAGASAPGVAMRAGTPAMAVERSASIPFLKKPPALDGSMVGDVGFDPLGISTTIIELGGDLRYVREAELMHGRQAMLATVGFVFPKLFGKLPAEWAKDISLNPLEAQYQIPPVALGQIAISIAIAEGLRSRIVFSNDPDYVVGDHGFGAGMLKGKSEAQVKDMKMKELAHCRLAMVAITGMFFQTAITGSLYPLVDKF

Entity 4 Entity 4 polymer

Description description	EFCPI-6
Molecular weight formula_weight	27147.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MLVAALTSSPALVAPAVAPLFAKPKLALAPHSDALRFARMEEAAAAPATEEAEEAEEVDPGPPPPPPVVYSEALPFLVRRESLGPVGALVGDVGFDPLGFTEILPLAWLREAEIKHCRTAMLATFGFAFTDFWHFPGFDYTTLEAHDAVIAQGGMSQLLLWIGLLEVFSAISIDQMLRGSGREPGDYGFDPLGFASDPAKKADLQMKELANGRLAMFAFGGFVTQSVLTGNTFPYLFDYQTAGDIVAIAAQGASP

Entity 5 Entity 5 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	22394.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MLALSSTAALSFAGPGLAGVSSRAGGAAMVAKSKAIPFLDAPPALDGTMAGDKGFDPLLLSNVVPIQWAREAELKHARICMLAVVGWVTVDLGFTVPYAPQVSSLAAHDAAVDKGVFLGLLIPIALVEVLAGIPKCFQIMNEPDASPGGDYKFDPLGIGASAEMQEKEISNGRLAMLAFSGIVTQAALTQGPFPYTYNGVEDLVPPMQSVQGALSIL

Entity 6 Entity 6 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	25430.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLSVVAPQLSLSTAHVVGARRAPAVQMAAGPMYDQPLAPSTMGREFINSARKPLSEYVGASQELAAFPGGGGKEGAAPVPWDPLQLSELWKVSANNPDVAWLREAELKHGRMSMLAITGVMVQSAGIHLPGNADISFANADWAMAPTTLPPAAWGQVLFFIGLAEGQTSAGLFDLWLGNTEKREPGNLGWGTQFLSKDKKAADKMRLKELKNGRLAMLAIMGVAFNHVIPGALPGCMYN

Entity 7 Entity 7 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	20761.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MLSLASPTACGFAAPLAPRSAVRSASPSMLAVTDLVGASTEVSNKVWDPLKLSENMDESNLKLVRAAELKHCRVAMLATVGWLWTATGTHFEGMLSTSSGVSFADVAAAGPLLGAAKVPAAGIWQMIAAIGALEVYWENKYPAAECGGDFGVPRVTQDPAKFKEIQLAELKNGRLAMIGIISFACAEAIPGSVPFYPF

Entity 8 Entity 8 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21065.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MLSLTVNSLSLNAGLPAVRAGRSPAPAMGVKSQALPFMDAPAPLDGSMAGDKGFDPLNLSGSFDIKWMREAELKHGRVCMLAWVGYVAVDNGFYVPFAPHVSSLAAHDAAVKAGPMLGLLLAVGAIEAISYNAIAEMMSGETDRRPGDFYLDPFNLCSTPEKLESMLEKEISHCRLAMFAFSGVVTQSALTGGAFPYTS

Entity 9 Entity 9 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21042.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLAAASSLPLALVQSGAALRAPQLQPLSAQLKVNGMVGDCKPLGYFDPLGFSKDASPETMAKFREAELKHGRVAMLACAGMITADKFHPLFGGKLSSNPLLAITQVPKLGLLQILLFIGFMEVFGILNSRRPDYEPGNFLGTSQWETTPTWDAYQLRELNNGRLAMFGAIGMLTHAYITGKGPLELLDAGNGGIVF

Entity 10 Entity 10 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21689.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLAFASSPLSFSAPALARPAAALRGAASMGLAPPVEKSQALPFAERPAKLDGTLVGDVGFDPLGLSNILPIEWMREAELKHGRVCMLAVVGYIVVDKGLRAPGAEKLVAATSSFTAHDAAVQSGHMWALLLACGLFEIVGAGAIASTLNGGDRKPGEFALTGGFDRDAAKLERFKLAEIKHSRLAMMAFSGLVTQDALSHGATGFPYF

Entity 11 Entity 11 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	22109.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MLALTSCSGPSFAAPLAPATRAARGAASPTMGVETELGATGPLGYWDPFGFSVRNPERFNRYRAVELKHGRIAMAATTGYMVQSFLRWPGYLSTSANIKFADLPNGIAAFKAIPPAGLFQILLFIGAMEAFTWRYYEGPWPGKVPEGKAPGDVAGDLWVRYTDPEEKAFKLNAEINNGRAAMMGSLGMLMHDHILGTWVPPGFE

Entity 12 Entity 12 polymer

Description description	EFCPI-12
Molecular weight formula_weight	24057.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MLSLPQSSFALSAPVSAMRGVVRSGLAPRMGVETMEGVGPETGNKVFDPVGFATLGGDETLAFFRHAEIKHGRVAMAAMVGFLFHINHIHFPGYLSPTAGVTFEQLSAVGPFEAWNMIPLLGQLQILWTIAGLEHASECLDPAGHYTKGGTPGNLKFLKNFWDTPGFTKKLTEAQKAEKLVSELKNGRLAMIGIASVCAATAVPGSVPLLANAPALTGPGFALPFGTF

Entity 13 Entity 13 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	23617.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,P,W

MAMMLSSLAAPALLAPVAPIARAPAAASAKMALVDSMEGVGEETGGQIWDPLGISEAVSDEAVMWFRASELKHGRVAMLASVGYLVGAAKISFPGELAKGVTFASVAANGPYQAWDAVPQAGKLQILSIILALEWATEAKKPHYMRGGVPGKIEQLPFDGIQGLWAPKIKFWDPLNFTGALSAEQKARKRKAELKNGRLAMIGIISFITGHNLPGSVPALDSSF

Entity 14 Entity 14 polymer

Description description	EFCPI-17
Molecular weight formula_weight	23840.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSLSLLSSAPVGFAAPLPAVRPVAQPRPLTMSAADGMEGAAHETGFTTWDPLGLADLGSPATLAFFRHAELKHCRVAMAAFTGWLVAVSGVHFPGLCSFSEGISFEDISQLTPMEQWGAVPALGKAQILLAIGIIEHQSEWKIKPHYMAAGGKPGDLKGLKSFWDPIGLTSKMDAKKLERQRLSEIKNGRLAMIGIVSVLIANNMPGAIPLPIAFPAGPSLVLPF

Entity 15 Entity 15 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21835.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,R,T

MLSLTVNSVSFNGPALAPRVAPAAAAGVRMGVSDMEGTGPETGGKVFDPMGLSKIASAETLAWYRAAELKHSRVAMAAVTGWAWVSSGGPLFPGYLSVEQGVTFESLGRDGYAAWAAVPEAGKFQILGVIGILEILSESAVKPHYMAGGTPGKVPLLWDPLGFTAKLSPETLARKRLAELKNGRLAMIGVMSLVSAHFIPNSVPLLPGSV

Entity 16 Entity 16 polymer

Description description	EFCPI-18
Molecular weight formula_weight	19804.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MLGAISPLALGLAGAAAPSVAVTRAAVSMAGSVDSMIGKYSIKGTVYDPLDLASKYDVNWLREAELKHGRVCMLAVAGFLANDAGWGLPGLDIKCSSIEAHDRMVESGHMWALLAVVGVCEFLHFSVVVPKLDGDWGDWEPGNYGLDPFKLDSPSRREAELKNGRLAMLAFSGLVTQAALGHAAPYI

Entity 17 Entity 17 polymer

Description description	EFCPI-22
Molecular weight formula_weight	26558.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MALLSLAPSCLGLATPLRAAPPLASSRAAAVSMDYSKEELATALNPVVGYFDPLGLATADFWSQGNEATWGWLRHAEIKHGRVAMFAFVGYIAQYNGLHFGFPLSLPESPSYAAGLTPPEQWDALPLLAKAQIFTFIGFLEFWSELGMETHYMKGGRPGDYPDFPKAGVIPVTPVKVFNLYDPFGFAGKRSEEQKAKGLLAEINNGRAAMIGIMAFLAEQKIPGSVPWGPHLKPYAGEVMAPFMP

Entity 18 Entity 18 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	21708.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MLSLALSPLSLSGLAPRSAVSSSRVAAPQMVQSKSMPMMEAPEHLQGMVGNVDFDPLGLSSPNNIKWMREAELKHGRMSMLAWTGYVAVDLGLRFPGARYAELNSFNAHDVVAKKELFLLLLWVGTFETIGASQIYDMSIDQSERKPGDFGFDPLRLLKSPEAPKYYEAELVHGRAAMLAFSAVVTQSALGNTAFPYF

Entity 19 Entity 19 polymer

Description description	LEFP
Molecular weight formula_weight	12203.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MLALASASYGLTVGVPAAPAAGRAAAPTMAAAESRRNVLAAALLLAPSAANAMTIPGLNAPGLVPATKKPAGAKPSFESYRDTSHFWSSQGIMDSVPKVKGIVTPKTPVGYGAPKAPEPPAAS

Entity 20 Entity 20 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	27282.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MLSASVALSAGSAAITAPVAAPGRGAVRAAAPALMDKSGLEGFAKELNPVVGYWDPLNLSNGEFWGDSNSATIGFLRESEIKHGRVAMAGFVGYIVHANDIRFPWDKVAMAAPKGLSPQELWDVTPEAAKWQIILTIAFLEFWRENSYILSKEGEQHYMRGGKPGYFPTFSELPHPVPFNLFDPFGFSKNASPEKKAKGLLAEVNNGRLAMIGLMGFLSEAKVPGSVPALANVGIRPYAGEVMAPFDANFHLF

Entity 21 Entity 21 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	26276.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MLAAAVSTPLSFAGAAAAPLARASAPAMSALPELSKKLNPVLGYWDPLNLAELNFWGAGDDATVGFLRHAEIKHGRVAMAAFVGYCVQSNVHFPWAPFNSIPTNIAPAEQWAQLPEAAKWQIILFVGFLEVYSEHSFILEKYGQKHYMKGGKPGFFPDFDTMVHPVPLNLWDPLKAYKGASAERKADGLLKEVNNGRLAMIGIMGFCAEARVPGAVPALSNIAHYAGDPMAPFAANFHLPGFAS

Entity 22 Entity 22 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	27517.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MLLAGSSALSLSYVAPAAPAAAVRGGAVRMESLSDLKTLATGLNPVVGYWDPLKLGEAEFWDNTNEETIGWLRHAEIKHGRVAMAGFVGFIVQANGIKFPWAPFNAITSTSPPEQWDQLPDAAKWQIILGVGFLEWWSEIRVDGTPHYMKGGKPGYVPDFDATPDQLPHWVGLNLYDPLKWSKGASAEKKQKGLLTELNNGRLAMLGIMGFVSEAKVPGSVPLLKGLVAPYTGEVMAPFATDIDWSSWAYIPGA

Entity 23 Entity 23 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83647.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MKVGSKELEASKVRVIVDKDPVATSFEKWAQPGHFSRTLAKGPKTTTWIWNLHADAHDFDSQTSSLEDISRKIFSAHFGQLAIIFLWVSQAYFHGARFSNYSAWLLNPTSIKPSAQVVWPVVGQEILNGDVGGGFSGVQITSGVFQMWRASGITNETELYWTAMGGLMMSALMVFAGWFHYHKAAPKLEWFQNVESMMNHHLAGLLGLGCLSWSGHQIHISLPINKLLDAGVAPQEIPLPHELLFNQDLMAQLYPSFKKGLLPFFTLNWGEYSDFLTFKGGLNPITGSLWLSDTAHHHLALAVLFIFAGHMYRTNWGIGHSMKEILEAHKGPLTGEGHKGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYIAVDYPTQLSLFTHHMWIGGFCVCGAAAHGAIFMVRDYSPVQSYNNLLDRVLRHRDAIISHLNWVCIFLGTHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAKWVQSLHTLAPGNTAPNSLATASYAFGGDVVAVNGKIAMMPIQLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHIFLGLFWMYNCISVVIFHFSWKMQSDVWGTISEKGKITHITGGNFANSALTINGWLRDFLWSQASQVIQSYGSALSAYGIIFLGAHFIWAFSLMFLFSGRGYWQELIESVVWAHNKLKLAPAIQPRALSITQGRAVGLAHYLLGGIGTTWSFFLARIISVG

Entity 24 Entity 24 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82101.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MATKFPKFSQALAQDPATRRIWYGIATAHDLESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFQQWVLNPLKVKPIAHAIWDPHFGQSAIKAFTRGGVSYPVNIATSGVYHWWYTVGMRTNEDLYFGALGLLVLSTTLLFAGWLHLQPKFRPGIAWFKNNESRLNHHLSGLFGVSSLAWSGHLIHVAIPESRGQHIRWNNFTSTLPHPEGLTPFFTGNWGLYAENPDTAQHIFGTSEGAGTAILTFLGGFHPQTQSMWLTDIAHHHLAIAVVFIFAGHMYRTNWGIGHSMKEILDAHVPPKGRLGAGHRGLFETITDSLHMQLGLALASLGVATSLVAQHMYALPSYAFMAKDYVTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPEVNKDNVLARMLQHKEAIISHLSWVSLFLGFHTLGLYIHNDVCVAFGTPEKQILFEPVFAQFIQAASGKALYGFDVLLSSSTSAASVASSKIWLPGWMEAINSGKNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTISWVTFYWHWKHLTVWGGNAAAFNESSTYIMGWLRDYLWLNSSPLINGYNAFGMNAQAVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPIANLVKWRDKPVALSIVQARLVGLAHFTVGFIFTFAPFVIASTTGKFA

Entity 25 Entity 25 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8809.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSHSVRVYDTCIGCTQCVRACPCDVLEMVPWDGCKAGQIASAPRAEDCIGCKRCETACPTDFLSVRVYLGSETTRSLGLTY

Entity 26 Entity 26 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15898.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTSDVLNLQIPTPTFGGSTGGWLRAAEIEEKYAITWTSKKEQIFEMPTSGAAIMQKGENLLYLAKKEQCLALSTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGVFPEKLNEGRIGVGNVGYSIGKNPNPVNVKFTGKNTFD

Entity 27 Entity 27 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	13501.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MRSALLLALAAPAAALAPGSMLSSSRVVCRGGAPDMIERGSKVRVLRPESYWFQECGSVATIAKGGDRYPVVVRFEKVNYAGVATNNFALDELGEVEAPAKKKAAKAAPAAKEGAPAAKAAPAAKEVAAKK

Entity 28 Entity 28 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	20000.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MKVLLNWLLVASLFAASPKAAFADVSGLTPCKDSAVFKKRLDGSVKKLQARLANYTEGTPAYLALEQQIDQTKARFAKYGDKGLLCGADGLPHLIADGRPDHAGEFVIPAFGFLYIAGWIGWAGRSYLQFSKKTDKPNENEIIINVPVALGMMSGAFLWPLAAWKELINGQLLVPGDEVTVSPR

Entity 29 Entity 29 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3971.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSASFLPSILTPVVTLVFPGLMFALFFVLIEQEEIA

Entity 30 Entity 30 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4539.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSKDLLKYLSTAPVLLTAWMSLTAGMIIEIQRFFPDSLSF

Entity 31 Entity 31 polymer

Description description	PSI-K
Molecular weight formula_weight	11631.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MRPAVMRPTMAAPVQMSLDPVTAADSASHATQLLALALPIPQFNPAKAFIMMFSNILIICTMSIQGKSLARGTPHDEMVESFGITWLLAGTSLGHIVGAGAILGCTAAGFLA

Entity 32 Entity 32 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	15488.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MSEFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIGPFYILGPLRNSPNALLVGLFSAFGLILILTLGLTIYGLASFQGTEGGENLESAKGWRNFTSGFSIGAFGGASVAYVLLDNISFFA

Entity 33 Entity 33 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3213.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MITDSQIFFALCIALTAAVLAIGLGRQLYV

Entity 34 Entity 34 polymer

Description description	EFCPI-30
Molecular weight formula_weight	28691.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MSLSLLSSAPVGFAAPLPAVRPVAQPAAARSTPPVMETIDDLKSLAVKANPVVGYWNPTPLADMGFWGQSQEATIGFLRHAELKHGRVAMAAFVGFCLQSNGVHFPWACTLEGTTFGDIAAAGGPAAQWDALPTNAKLQILLLIGFFELLSENTYALAQSGQKHYMRGGKPGVFPSLKKVGIPVPVPLDLWDPFGFTAKMSQEKKDAKLVTELNNGRAAMLGIMGFVAASKVPGSVPALDGLIAPYSGEVMAPFSAGDSALPFVEGMLKASPF

Entity 35 Entity 35 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	27307.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p,u,x

MLALTSSSLSFAPAVAPRAAVSGPVMSAKADLEAFAKECNPVVGYWDPLGLADLPLWGQDQDAVIGWLRHSEIKHGRIAMAGFVGYIAHANGFRFGGIGPQNVVPEGASAPEVWDSIPFLAKLQIIGAIGVLEHISEDKNFLAADGMKHYMRGGKPGYFPTFSANVHPMPLNLFDPFKWSKNASPEKKAKGLVTETNNGRLAMLGLFGFLSESKIPGSVPALSGIIPSYDGDYMQPFLPTGPDTSLWTIGNLWAN

Entity 36 Entity 36 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	28328.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,v

MLSLASASTLSLAPAALMRAPAVRTAAPVMESKAELESLAGKLNPVIGYWDPLNLADYDQWSQGQEAAIGFLRHAEIKHGRVAMAAFVGYIVQSNGICWPWALTGGPNGVMHSDILAAGGPADQWDALPTASKLQILLFVGGLELWSENSYVLGLSGEKHYMRGGKPGFFPSIKKGGIPHPVPFDLFDPFGLSKNASPEKKAKGLLAEINNGRLAMLGIMAFVSESKVPGSVPALAGKIAPYSGEVMAPFAASDNLPFVADMLKSPLF

Entity 37 Entity 37 polymer

Description description	PsaR
Molecular weight formula_weight	13621.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MKGALAFLCLLGSAAAFAPAALRPAVMQRSVAAAPAAAGAVMVDRSEAADTWWGDKDYPPSIVLGIGKDVPSSIFGVTSGLAFAIGVYCVAQSNLVNILSGSTVNGFYVAGALLVPYSWGLHVAAWIQKQNGK

Entity 38 Entity 38 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	28110.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t,w,y

MSFADEFTFDSKPWSSSEIKDKAGLEALAKKLNPTVGLWDPLGIAETSPETIGWFRHAEIKHGRVAMAAFVGYCVQSNGIHFPWNIQGWQGTPVVSFADIAAAGGPADQWDALSTPAKLQILGVIGFLEMWSETSVVLKADGQEHYVRGGKPGYFPKLSRSDEMAFPHPVPLNLWDPFGFTSKMTPERKEKALLAEVNNGRLAMIGIFGMISASKGLQVPGLDTVGIKPYAGEVMAPFAAGDASLPFVSGMLEKIGTYGY

Entity 39 Entity 39 polymer

Description description	Light harvesting protein
Molecular weight formula_weight	27669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MLATASTLSLSYAAPAAPAGASLRHARPAAAPPLMETKADLEALAKDLNPAVGFWDPLALSDYSFWGTSQEATIGFLREAEIKHGRIAMAGFVGYIVHSNDIRWTFDKVAASVPTGLPAPAVWDAIPDIAKWQIILFVGVMESWRENKVVLEAEGQKHYMSGGKPGYFPSFDLLPHPVPFPLFDPFGISKRATEEKKAKGRLAEINNGRLAMIGLFGFLSEATVPGSVPFLKGVVPAYTGEVMAPFTQNIFTAPTAL

Entity 40 Entity 40 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	387

Entity 41 Entity 41 non-polymer

Description description	Chlorophyll c2
Molecular weight formula_weight	608.9 kDa
Source method src_method	syn
Copy count entity_count	121

Entity 42 Entity 42 non-polymer

Description description	(3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol
Molecular weight formula_weight	582.9 kDa
Source method src_method	syn
Copy count entity_count	73

Entity 43 Entity 43 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 44 Entity 44 non-polymer

Description description	;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ;
Molecular weight formula_weight	658.9 kDa
Source method src_method	syn
Copy count entity_count	109

Entity 45 Entity 45 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 46 Entity 46 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 47 Entity 47 non-polymer

Description description	;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-2-[2-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]ethenyl]-6,11,15-trimethyl-16-oxidanylidene-17-[(1~{S},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]heptadeca-2,4,6,8,10,12,14-heptaenyl] hexanoate ;
Molecular weight formula_weight	773.0 kDa
Source method src_method	syn
Copy count entity_count	42

Entity 48 Entity 48 non-polymer

Description description	;[(2~{Z},4~{E},6~{E},8~{E},10~{E},12~{E},14~{E})-17-[(4~{S},6~{R})-4-acetyloxy-2,2,6-trimethyl-6-oxidanyl-cyclohexylidene]-6,11,15-trimethyl-2-[2-[(1~{R},4~{S},6~{R})-2,2,6-trimethyl-4-oxidanyl-7-oxabicyclo[4.1.0]heptan-1-yl]ethynyl]heptadeca-2,4,6,8,10,12,14,16-octaenyl] dodecanoate ;
Molecular weight formula_weight	839.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 49 Entity 49 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 50 Entity 50 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 51 Entity 51 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 52 Entity 52 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	93213

Cryo-EM structure of coccolithophore photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light harvesting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer