SAXSdb — 9ui2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable transaldolase

Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 10	SULFATE ION × 19 1,2-ETHANEDIOL × 27 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAL_THET8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 21–243； UniProt 1–223 Author chain B； PDBConstruct 21–243； UniProt 1–223 Author chain C； PDBConstruct 21–243； UniProt 1–223 Author chain D； PDBConstruct 21–243； UniProt 1–223 Author chain E； PDBConstruct 21–243； UniProt 1–223 Author chain F； PDBConstruct 21–243； UniProt 1–223 Author chain G； PDBConstruct 21–243； UniProt 1–223 Author chain H； PDBConstruct 21–243； UniProt 1–223 Author chain I； PDBConstruct 21–243； UniProt 1–223 Author chain J； PDBConstruct 21–243； UniProt 1–223

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ui2
Deposition date deposition_date	2025-04-15
Structure title title	Crystal structure of Thermus thermophilus HB8 transaldolase
Keywords keywords	nonulose, octulose, transaldolase, rare sugar, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ui2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ui2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ui2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.49 Å
Rg (electron density)	39.72 Å
Total Rg	40.16 Å
Atom count	17253
Residues	2250
Excluded volume	310180 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ui2__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Probable transaldolase
Molecular weight formula_weight	26223.3 kDa
EC 编号 ec_number	2.2.1.2
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J
Atom count atom_count	18735

MGSSHHHHHHSSGLVPRGSHMELYLDTASLEEIREIAAWGVLSGVTTNPTLVAKAFAAKGEALTEEAFAAHLRAICETVGGPVSAEVTALEAEAMVAEGRRLAAIHPNIVVKLPTTEEGLKACKRLSAEGIKVNMTLIFSANQALLAARAGASYVSPFLGRVDDISWDGGELLREIVEMIQVQDLPVKVIAASIRHPRHVTEAALLGADIATMPHAVFKQLLKHPLTDIGLKRFLEDWEKVKP

Source Source

Source organism organism	Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
NCBI taxonomy ID ncbi_taxonomy_id	300852
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1482

▶

Unit-cell length a length_a	173.380 Å
Unit-cell length b length_b	173.380 Å
Unit-cell length c length_c	422.580 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	120

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	49.750 Å
R factor r_factor	0.1905
R_work r_work	0.1894
R_free r_free	0.2111

Crystal structure of Thermus thermophilus HB8 transaldolase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable transaldolase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ui2__assembly_1__model_1

9ui2__assembly_1__model_1 | I(q)

9ui2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of Thermus thermophilus HB8 transaldolase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable transaldolase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ui2__assembly_1__model_1

9ui2__assembly_1__model_1 | I(q)

9ui2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)