← Back to search

9uk7

Crystal structure of WDR5 in complex with peptide Ac-MRTEP-NH2

Method: X-RAY DIFFRACTION D_max: 121.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uk7
deposition_date	2025-04-17
title	Crystal structure of WDR5 in complex with peptide Ac-MRTEP-NH2
keywords	WD repeat, WIN site, MLL complex, NUCLEAR PROTEIN; NUCLEAR PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.37 Å
rg_electron	36.19 Å
i0	153833000.00
molecular_weight	101860.0 kDa
excluded_volume	127990 Å³
envelope_volume	154540 Å³
shell_volume	36389 Å³
envelope_diameter	122.2 Å
shell_rg	41.45 Å
envelope_rg	35.72 Å
shape_rg	36.17 Å
total_rg	36.57 Å
total_atoms	7173
n_residues	925
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	121.9 Å
rg_real	36.54 Å
rg_real_error	1.20 Å
i0_real	1.5380e+08
i0_real_error	2.8720e+06
rg_reciprocal	36.44 Å
i0_reciprocal	153800000.0000
total_estimate	0.8266
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	28.3 Å
skewness	0.317
kurtosis	-0.692
angular_range	— – 0.2150 Å⁻¹
current_alpha	0.0000
highest_alpha	72720000.0000
n_real_points	44
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.738; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.664; Smooth: 0.865

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	WD repeat-containing protein 5
formula_weight	34391.0 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	A,B,C
atom_count	8315

SATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 polymer

description	ACE-MET-ARG-THR-GLU-PRO-NH2
formula_weight	657.8 kDa
src_method	syn
entity_count	3

Polymer

type	polypeptide(L)
strand_id	D,E,F

XMRTEPX

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	1142

▶

6. Citations (1)

▶

length_a	231.077 Å
length_b	39.031 Å
length_c	114.962 Å
angle_alpha	90.00 °
angle_beta	118.89 °
angle_gamma	90.00 °
z_pdb	12

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	1.950 Å
resolution_low	38.370 Å
r_factor	0.1925
r_work	0.1912
r_free	0.2371

fit	/app/data/saxs_computation/uk/9uk7/9uk7.fit
pddf	/app/data/pr_computation/uk/9uk7/9uk7.pr.out
profile	/app/data/saxs_computation/uk/9uk7/9uk7.dat

Crystal structure of WDR5 in complex with peptide Ac-MRTEP-NH2

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)