SAXSdb — 9ukm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gp23

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Hdf × 1 （Q71TE2） Defense against restriction protein A × 1 （O21970）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q71TM1_BPP1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–568； UniProt 1–568 Author chain B； PDBConstruct 1–568； UniProt 1–568 Author chain C； PDBConstruct 1–568； UniProt 1–568 Author chain D； PDBConstruct 1–568； UniProt 1–568 Author chain E； PDBConstruct 1–568； UniProt 1–568 Author chain F； PDBConstruct 1–568； UniProt 1–568 Author chain G； PDBConstruct 1–568； UniProt 1–568

Hdf

OrganismNot specified

UniProt Q71TE2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Gp23 × 7 （Q71TM1） Defense against restriction protein A × 1 （O21970）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q71TE2_BPP1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–203； UniProt 1–203

Defense against restriction protein A

OrganismNot specified

UniProt O21970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Gp23 × 7 （Q71TM1） Hdf × 1 （Q71TE2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DARA_BPP1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–639； UniProt 1–639

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ukm
Deposition date deposition_date	2025-04-18
Structure title title	Cryo-EM structure of bacteriophage P1 head
Keywords keywords	head, phage, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ukm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ukm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ukm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	80.76 Å
Rg (electron density)	82.35 Å
Total Rg	82.47 Å
Atom count	26773
Residues	3452
Excluded volume	476890 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ukm__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Gp23
Molecular weight formula_weight	62326.4 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	26773

MSNLREYQNRIADIAKRSKAVLGWASTAQFGTDNQFIKDDAARAASILEAARKDPVFAGISDNATAQIATAWASALADYAAAHKSMPRPEILASCHQTLENCLIESTRNSMDATNKAMLESVAAEMMSVSDGVMRLPLFLAMILPVQLGAATADACTFIPVTRDQSDIYEVFNVAGSSFGSYAAGDVLDMQSVGVYSQLRRRYVLVASSDGTSKTATFKMEDFEGQNVPIRKGRTNIYVNRIKSVVDNGSGSLLHSFTNAAGEQITVTCSLNYNIGQIALSFSKAPDKGTEIAIETEINIEAAPELIPLINHEMKKYTLFPSQFVIAAEHTVQAAYEAQREFGLDLGSLQFRTLKEYLSHEQDMLRLRIMIWRTLATDTFDIALPVNQSFDVWATIIRGKFQTVYRDIIERVKSSGAMGMFAGADAASFFKQLPKDFFQPAEDYIQTPYVHYIGTLFGNVKVYEVPAGICKNLTTENIQFSSMDVLCYVRDENPGKAGFVTGDAVPAIPFQHPTTPALVNRTTLWGSAINDMHPRNGADYFTRVTLTMAKKGGLNFISGDTIDAGDSE

Entity 2 Entity 2 polymer

Description description	Hdf
Molecular weight formula_weight	22189.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MCQMTKNKYATVDFDQVNEKGLKSLITAINKTGVTVIEVDSSNRATTKDGVKVKTAKLVLSDGQILAIQVNDTGDISSVKLNGKAIPNAQSPDIKTLGTVMGQAARKNSAKFQKSLIAKAKRVANPVDKKPAVKSNFQRLQEAKQRNAQVVAAYKSAQNSVSFNQQQITDLRAKLDKETGRLNNEKARNGELKRRLKQLKAGN

Entity 3 Entity 3 polymer

Description description	Defense against restriction protein A
Molecular weight formula_weight	69550.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MEQFNINKGMTIKPGLDVLPPPVTDDEYRALMAGEDRYLMTESNTLEEIEATFFYDTPIHWCATDLLEAISSTRLQLHRTMQAFVRALNQKLNGTGISAGSDKTGDVAQSGARAIGGAEIGRARNVNGLPVLPAIIPLSDGQTISILFHSPTAENRITNSDTLVAFQFLLNKKDVTHTVAPMSGRDMTLAQVTMKLANLAEKNSAKFQRAQKKKKALVDEITQLQADSDQKEDAMSDLADQVAAVEGQKADLEQKINAVASEADSLYEENERLQGEIDRLNRTGGRDTIAPAGMTGGHSRALTDRLASIKNRMHMDGEATLSNGASMKQFIGDGEGYIQLTDPDGSVYMIKAKSIQGVDMADAIGKLFKAYKAGNVSEYLVQPEEHKPENVEPESAEDTGSSSPEPEVSVGAYRYALQMRPAAPGAIPEGNKAILPRPDEGDPYYEYARYGIATYDTPLSDQQMSEYDLKLLPREDSFDFLAKTLTNGPFGKYAQKALELATNSPDEFRVMLKTQFQKTFPNIAFPGGAGTEKMVQSMINALQAEVGEITQPEPAPAQPDETVSEADAEANKAIEYLNNVMDMQSTDMAEIRNARGNVREAIAALQTAGRFEENEELVNGAARHLADLLVAIQKAGVAA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.600 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11800

Cryo-EM structure of bacteriophage P1 head

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gp23

State in the Current Structure

Other States of the Same Protein in the Database

Hdf

State in the Current Structure

Other States of the Same Protein in the Database

Defense against restriction protein A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ukm__assembly_1__model_1

9ukm__assembly_1__model_1 | I(q)

9ukm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of bacteriophage P1 head

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gp23

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hdf

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Defense against restriction protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ukm__assembly_1__model_1

9ukm__assembly_1__model_1 | I(q)

9ukm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)