← Back to search

9uli

Drosophila melanogaster Nicotinamidase in Complex with Inhibitor CN5

Method: X-RAY DIFFRACTION D_max: 79.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uli
deposition_date	2025-04-19
last_revision	2026-04-22
title	Drosophila melanogaster Nicotinamidase in Complex with Inhibitor CN5
keywords	Nicotinamidase, Inhibitor, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.55 Å
rg_electron	22.62 Å
i0	24367500.00
molecular_weight	37108.0 kDa
excluded_volume	46108 Å³
envelope_volume	53963 Å³
shell_volume	21113 Å³
envelope_diameter	83.3 Å
shell_rg	28.38 Å
envelope_rg	22.83 Å
shape_rg	22.47 Å
total_rg	23.79 Å
total_atoms	5113
n_residues	327
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	79.3 Å
rg_real	23.69 Å
rg_real_error	0.68 Å
i0_real	2.4370e+07
i0_real_error	3.3680e+05
rg_reciprocal	23.66 Å
i0_reciprocal	24370000.0000
total_estimate	0.7815
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.8 Å
skewness	0.500
kurtosis	-0.287
angular_range	— – 0.3350 Å⁻¹
current_alpha	0.0000
highest_alpha	4033000.0000
n_real_points	65
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.763; Stabil: 0.998; Sysdev: 1.000; Positv: 1.000; Valcen: 0.871; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	nicotinamidase
formula_weight	40164.1 kDa
ec_number	3.5.1.19
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5240

MDSPTPPIVIEDSNGSAMDACFTAFDKDSDDRLSLAEFSIICRALFRNDKGHIYDVPPERLEQIFAVFDTNGDGFIDREEFKFCWNQWIKTIVRPVNAFLIVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWHPSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHCVQDSWGAELHKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQLKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIEHTKEKVNTSDGVIVHTNQVKAMAEGRDRRPELGYKLAMELKSPDSVLSQRNGFRPSY

Source

organism	Drosophila melanogaster
common_name	fruit fly
ncbi_taxonomy_id	7227
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	FE (II) ION
formula_weight	55.8 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	3-(cyclopropylmethyl)imidazole-4-carboxamide
formula_weight	165.2 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	127

▶

6. Citations (1)

▶

length_a	75.154 Å
length_b	70.110 Å
length_c	76.464 Å
angle_alpha	90.00 °
angle_beta	94.44 °
angle_gamma	90.00 °
z_pdb	4

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	1.659 Å
resolution_low	43.580 Å
r_factor	0.2221
r_work	0.2206
r_free	0.2560

fit	/app/data/saxs_computation/ul/9uli/9uli.fit
pddf	/app/data/pr_computation/ul/9uli/9uli.pr.out
profile	/app/data/saxs_computation/ul/9uli/9uli.dat