SAXSdb — 9un4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Juvenile hormone acid O-methyltransferase

Tribolium castaneum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	MAGNESIUM ION × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	MAGNESIUM ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2DCQ0_TRICA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–277； UniProt 1–277 Author chain B； PDBConstruct 1–277； UniProt 1–277

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9un4
Deposition date deposition_date	2025-04-23
Last revision last_revision	2026-04-29
Structure title title	Crystal structure of juvenile hormone acid methyltransferase castaneum JHAMT3 from Tribolium castaneum
Keywords keywords	juvenile hormone, enzymatic activity, inhibitor screening, pest control, HORMONE; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9un4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9un4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9un4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.19 Å
Rg (electron density)	19.96 Å
Total Rg	20.95 Å
Atom count	4308
Residues	262
Excluded volume	38866 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9un4__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9un4__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Juvenile hormone acid O-methyltransferase
Molecular weight formula_weight	32305.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	8617

MNKASLYSKYSGLQKNDASFVIDNYLRLIKWKPNANILDIGSGDGNVIFELLLPKIPKHFAKFVGTDISEEMVLFAKNQCNDPKIDFLQMDISATIPPEFHEYFDHIFSFYCLHWVVEQRQAMKNIFDMLKPGGEMLLTFLASNPIYDIYERMAKSNKWGPYMNNLKKYISPYHHSEDPETELENLLKKEGFITHLCRVENRSYTFPSFSVLSKSVSAVNPFIKKLPENEIDTYIEDYLKEVRKLKTITIETCNNNDNEEKIHVPYKLFVTFASKPV

Source Source

Source organism organism	Tribolium castaneum
Common name common_name	red flour beetle
NCBI taxonomy ID ncbi_taxonomy_id	7070
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▶

Unit-cell length a length_a	58.597 Å
Unit-cell length b length_b	71.476 Å
Unit-cell length c length_c	133.984 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	48.880 Å
R factor r_factor	—
R_work r_work	0.2449
R_free r_free	0.2945

Crystal structure of juvenile hormone acid methyltransferase castaneum JHAMT3 from Tribolium castaneum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Juvenile hormone acid O-methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9un4__assembly_1__model_1

9un4__assembly_1__model_1 | I(q)

9un4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of juvenile hormone acid methyltransferase castaneum JHAMT3 from Tribolium castaneum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Juvenile hormone acid O-methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9un4__assembly_1__model_1

9un4__assembly_1__model_1 | I(q)

9un4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)