← Back to search

9uxg

Structure of WDR5 in complex with Peptide 2

Method: X-RAY DIFFRACTION D_max: 57.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uxg
deposition_date	2025-05-14
title	Structure of WDR5 in complex with Peptide 2
keywords	WDR5, WIN motif, chromatin, NUCLEAR PROTEIN; NUCLEAR PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	18.60 Å
rg_electron	17.58 Å
i0	18837100.00
molecular_weight	33487.0 kDa
excluded_volume	41942 Å³
envelope_volume	44669 Å³
shell_volume	20437 Å³
envelope_diameter	55.1 Å
shell_rg	24.62 Å
envelope_rg	17.75 Å
shape_rg	17.56 Å
total_rg	18.56 Å
total_atoms	2360
n_residues	312
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	57.2 Å
rg_real	18.44 Å
rg_real_error	0.19 Å
i0_real	1.8840e+07
i0_real_error	1.9930e+05
rg_reciprocal	18.47 Å
i0_reciprocal	18840000.0000
total_estimate	0.8972
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.1 Å
skewness	0.045
kurtosis	-0.522
angular_range	— – 0.4300 Å⁻¹
current_alpha	0.0000
highest_alpha	6332000.0000
n_real_points	74
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.896; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.976; Smooth: 0.997

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	WD repeat-containing protein 5
formula_weight	34646.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2530

GSHMTQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 polymer

description	Peptide 2
formula_weight	1997.4 kDa
src_method	syn
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

KCSRIIPARARVECFDK

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	164

▶

6. Citations (1)

▶

length_a	49.122 Å
length_b	46.714 Å
length_c	64.730 Å
angle_alpha	90.00 °
angle_beta	98.42 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	1.700 Å
resolution_low	41.760 Å
r_factor	0.2221
r_work	0.2210
r_free	0.2432

fit	/app/data/saxs_computation/ux/9uxg/9uxg.fit
pddf	/app/data/pr_computation/ux/9uxg/9uxg.pr.out
profile	/app/data/saxs_computation/ux/9uxg/9uxg.dat

Structure of WDR5 in complex with Peptide 2

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)