← Back to search

9uxo

Local refinement of maleic acid bound OXGR1

Method: ELECTRON MICROSCOPY D_max: 76.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uxo
deposition_date	2025-05-14
title	Local refinement of maleic acid bound OXGR1
keywords	maleic acid, MA, 2-oxoglutarate receptor 1, OXGR1, cryo-EM, membrane protein, SIGNALING PROTEIN; SIGNALING PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.88 Å
rg_electron	20.53 Å
i0	16501700.00
molecular_weight	33446.0 kDa
excluded_volume	43108 Å³
envelope_volume	49210 Å³
shell_volume	20370 Å³
envelope_diameter	77.6 Å
shell_rg	26.94 Å
envelope_rg	21.10 Å
shape_rg	20.47 Å
total_rg	21.69 Å
total_atoms	2352
n_residues	292
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	76.9 Å
rg_real	21.94 Å
rg_real_error	0.87 Å
i0_real	1.6500e+07
i0_real_error	2.2280e+05
rg_reciprocal	21.94 Å
i0_reciprocal	16500000.0000
total_estimate	0.8451
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.1 Å
skewness	0.407
kurtosis	-0.358
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	2796000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.715; Stabil: 0.996; Sysdev: 1.000; Positv: 1.000; Valcen: 0.859; Smooth: 0.991

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	2-oxoglutarate receptor 1
formula_weight	38284.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	R
atom_count	2356

MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 non-polymer

description	MALEIC ACID
formula_weight	116.1 kDa
src_method	syn
entity_count	1

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	4

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.970 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	2.97 Å
resolution_method	—
num_particles	436647

fit	/app/data/saxs_computation/ux/9uxo/9uxo.fit
pddf	/app/data/pr_computation/ux/9uxo/9uxo.pr.out
profile	/app/data/saxs_computation/ux/9uxo/9uxo.dat

Local refinement of maleic acid bound OXGR1

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D