9wg7

The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome rod-core linker polypeptide

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31LK9_SYNE7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 22； PDBConstruct 1–250； UniProt 1–250 Author chain 32； PDBConstruct 1–250； UniProt 1–250 Author chain 42； PDBConstruct 1–250； UniProt 1–250 Author chain 52； PDBConstruct 1–250； UniProt 1–250 Author chain A1； PDBConstruct 1–250； UniProt 1–250 Author chain A6； PDBConstruct 1–250； UniProt 1–250

C-phycocyanin alpha subunit

OrganismNot specified

UniProt P13530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_SYNE7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B1； PDBConstruct 1–163； UniProt 1–163 Author chain B3； PDBConstruct 1–163； UniProt 1–163 Author chain B4； PDBConstruct 1–163； UniProt 1–163 Author chain B5； PDBConstruct 1–163； UniProt 1–163 Author chain B6； PDBConstruct 1–163； UniProt 1–163 Author chain B7； PDBConstruct 1–163； UniProt 1–163 Author chain F1； PDBConstruct 1–163； UniProt 1–163 Author chain F3； PDBConstruct 1–163； UniProt 1–163 Author chain F4； PDBConstruct 1–163； UniProt 1–163 Author chain F5； PDBConstruct 1–163； UniProt 1–163 Author chain F6； PDBConstruct 1–163； UniProt 1–163 Author chain F7； PDBConstruct 1–163； UniProt 1–163 Author chain G1； PDBConstruct 1–163； UniProt 1–163 Author chain G3； PDBConstruct 1–163； UniProt 1–163 Author chain G4； PDBConstruct 1–163； UniProt 1–163 Author chain G5； PDBConstruct 1–163； UniProt 1–163 Author chain G6； PDBConstruct 1–163； UniProt 1–163 Author chain G7； PDBConstruct 1–163； UniProt 1–163 Author chain H1； PDBConstruct 1–163； UniProt 1–163 Author chain H3； PDBConstruct 1–163； UniProt 1–163 Author chain H4； PDBConstruct 1–163； UniProt 1–163 Author chain H5； PDBConstruct 1–163； UniProt 1–163 Author chain H6； PDBConstruct 1–163； UniProt 1–163 Author chain H7； PDBConstruct 1–163； UniProt 1–163 Author chain I1； PDBConstruct 1–163； UniProt 1–163 Author chain I3； PDBConstruct 1–163； UniProt 1–163 Author chain I4； PDBConstruct 1–163； UniProt 1–163 Author chain I5； PDBConstruct 1–163； UniProt 1–163 Author chain I6； PDBConstruct 1–163； UniProt 1–163 Author chain I7； PDBConstruct 1–163； UniProt 1–163 Author chain K1； PDBConstruct 1–163； UniProt 1–163 Author chain K3； PDBConstruct 1–163； UniProt 1–163 Author chain K4； PDBConstruct 1–163； UniProt 1–163 Author chain K5； PDBConstruct 1–163； UniProt 1–163 Author chain K6； PDBConstruct 1–163； UniProt 1–163 Author chain K7； PDBConstruct 1–163； UniProt 1–163 Author chain N1； PDBConstruct 1–163； UniProt 1–163 Author chain N3； PDBConstruct 1–163； UniProt 1–163 Author chain N4； PDBConstruct 1–163； UniProt 1–163 Author chain N5； PDBConstruct 1–163； UniProt 1–163 Author chain N6； PDBConstruct 1–163； UniProt 1–163 Author chain N7； PDBConstruct 1–163； UniProt 1–163 Author chain R1； PDBConstruct 1–163； UniProt 1–163 Author chain R3； PDBConstruct 1–163； UniProt 1–163 Author chain R4； PDBConstruct 1–163； UniProt 1–163 Author chain R5； PDBConstruct 1–163； UniProt 1–163 Author chain R6； PDBConstruct 1–163； UniProt 1–163 Author chain R7； PDBConstruct 1–163； UniProt 1–163 Author chain S1； PDBConstruct 1–163； UniProt 1–163 Author chain S3； PDBConstruct 1–163； UniProt 1–163 Author chain S4； PDBConstruct 1–163； UniProt 1–163 Author chain S5； PDBConstruct 1–163； UniProt 1–163 Author chain S6； PDBConstruct 1–163； UniProt 1–163 Author chain S7； PDBConstruct 1–163； UniProt 1–163 Author chain T1； PDBConstruct 1–163； UniProt 1–163 Author chain T3； PDBConstruct 1–163； UniProt 1–163 Author chain T4； PDBConstruct 1–163； UniProt 1–163 Author chain T5； PDBConstruct 1–163； UniProt 1–163 Author chain T6； PDBConstruct 1–163； UniProt 1–163 Author chain T7； PDBConstruct 1–163； UniProt 1–163 Author chain U1； PDBConstruct 1–163； UniProt 1–163 Author chain U3； PDBConstruct 1–163； UniProt 1–163 Author chain U4； PDBConstruct 1–163； UniProt 1–163 Author chain U5； PDBConstruct 1–163； UniProt 1–163 Author chain U6； PDBConstruct 1–163； UniProt 1–163 Author chain U7； PDBConstruct 1–163； UniProt 1–163 Author chain W1； PDBConstruct 1–163； UniProt 1–163 Author chain W3； PDBConstruct 1–163； UniProt 1–163 Author chain W4； PDBConstruct 1–163； UniProt 1–163 Author chain W5； PDBConstruct 1–163； UniProt 1–163 Author chain W6； PDBConstruct 1–163； UniProt 1–163 Author chain W7； PDBConstruct 1–163； UniProt 1–163

C-phycocyanin beta subunit

OrganismNot specified

UniProt P06539

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_SYNE7
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C1； PDBConstruct 1–173； UniProt 1–173 Author chain C3； PDBConstruct 1–173； UniProt 1–173 Author chain C4； PDBConstruct 1–173； UniProt 1–173 Author chain C5； PDBConstruct 1–173； UniProt 1–173 Author chain C6； PDBConstruct 1–173； UniProt 1–173 Author chain C7； PDBConstruct 1–173； UniProt 1–173 Author chain D1； PDBConstruct 1–173； UniProt 1–173 Author chain D3； PDBConstruct 1–173； UniProt 1–173 Author chain D4； PDBConstruct 1–173； UniProt 1–173 Author chain D5； PDBConstruct 1–173； UniProt 1–173 Author chain D6； PDBConstruct 1–173； UniProt 1–173 Author chain D7； PDBConstruct 1–173； UniProt 1–173 Author chain E1； PDBConstruct 1–173； UniProt 1–173 Author chain E3； PDBConstruct 1–173； UniProt 1–173 Author chain E4； PDBConstruct 1–173； UniProt 1–173 Author chain E5； PDBConstruct 1–173； UniProt 1–173 Author chain E6； PDBConstruct 1–173； UniProt 1–173 Author chain E7； PDBConstruct 1–173； UniProt 1–173 Author chain J1； PDBConstruct 1–173； UniProt 1–173 Author chain J3； PDBConstruct 1–173； UniProt 1–173 Author chain J4； PDBConstruct 1–173； UniProt 1–173 Author chain J5； PDBConstruct 1–173； UniProt 1–173 Author chain J6； PDBConstruct 1–173； UniProt 1–173 Author chain J7； PDBConstruct 1–173； UniProt 1–173 Author chain L1； PDBConstruct 1–173； UniProt 1–173 Author chain L3； PDBConstruct 1–173； UniProt 1–173 Author chain L4； PDBConstruct 1–173； UniProt 1–173 Author chain L5； PDBConstruct 1–173； UniProt 1–173 Author chain L6； PDBConstruct 1–173； UniProt 1–173 Author chain L7； PDBConstruct 1–173； UniProt 1–173 Author chain M1； PDBConstruct 1–173； UniProt 1–173 Author chain M3； PDBConstruct 1–173； UniProt 1–173 Author chain M4； PDBConstruct 1–173； UniProt 1–173 Author chain M5； PDBConstruct 1–173； UniProt 1–173 Author chain M6； PDBConstruct 1–173； UniProt 1–173 Author chain M7； PDBConstruct 1–173； UniProt 1–173 Author chain O1； PDBConstruct 1–173； UniProt 1–173 Author chain O3； PDBConstruct 1–173； UniProt 1–173 Author chain O4； PDBConstruct 1–173； UniProt 1–173 Author chain O5； PDBConstruct 1–173； UniProt 1–173 Author chain O6； PDBConstruct 1–173； UniProt 1–173 Author chain O7； PDBConstruct 1–173； UniProt 1–173 Author chain P1； PDBConstruct 1–173； UniProt 1–173 Author chain P3； PDBConstruct 1–173； UniProt 1–173 Author chain P4； PDBConstruct 1–173； UniProt 1–173 Author chain P5； PDBConstruct 1–173； UniProt 1–173 Author chain P6； PDBConstruct 1–173； UniProt 1–173 Author chain P7； PDBConstruct 1–173； UniProt 1–173 Author chain Q1； PDBConstruct 1–173； UniProt 1–173 Author chain Q3； PDBConstruct 1–173； UniProt 1–173 Author chain Q4； PDBConstruct 1–173； UniProt 1–173 Author chain Q5； PDBConstruct 1–173； UniProt 1–173 Author chain Q6； PDBConstruct 1–173； UniProt 1–173 Author chain Q7； PDBConstruct 1–173； UniProt 1–173 Author chain V1； PDBConstruct 1–173； UniProt 1–173 Author chain V3； PDBConstruct 1–173； UniProt 1–173 Author chain V4； PDBConstruct 1–173； UniProt 1–173 Author chain V5； PDBConstruct 1–173； UniProt 1–173 Author chain V6； PDBConstruct 1–173； UniProt 1–173 Author chain V7； PDBConstruct 1–173； UniProt 1–173 Author chain X1； PDBConstruct 1–173； UniProt 1–173 Author chain X3； PDBConstruct 1–173； UniProt 1–173 Author chain X4； PDBConstruct 1–173； UniProt 1–173 Author chain X5； PDBConstruct 1–173； UniProt 1–173 Author chain X6； PDBConstruct 1–173； UniProt 1–173 Author chain X7； PDBConstruct 1–173； UniProt 1–173 Author chain a1； PDBConstruct 1–173； UniProt 1–173 Author chain a3； PDBConstruct 1–173； UniProt 1–173 Author chain a4； PDBConstruct 1–173； UniProt 1–173 Author chain a5； PDBConstruct 1–173； UniProt 1–173 Author chain a6； PDBConstruct 1–173； UniProt 1–173 Author chain a7； PDBConstruct 1–173； UniProt 1–173

Phycobilisome rod linker polypeptide

OrganismNot specified

UniProt Q31PE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31PE0_SYNE7
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Y1； PDBConstruct 1–273； UniProt 1–273 Author chain Y3； PDBConstruct 1–273； UniProt 1–273 Author chain Y4； PDBConstruct 1–273； UniProt 1–273 Author chain Y5； PDBConstruct 1–273； UniProt 1–273 Author chain Y6； PDBConstruct 1–273； UniProt 1–273 Author chain Y7； PDBConstruct 1–273； UniProt 1–273

Phycobilisome rod linker polypeptide

OrganismNot specified

UniProt Q31PD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31PD9_SYNE7
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Z1； PDBConstruct 1–289； UniProt 1–289 Author chain Z3； PDBConstruct 1–289； UniProt 1–289 Author chain Z4； PDBConstruct 1–289； UniProt 1–289 Author chain Z5； PDBConstruct 1–289； UniProt 1–289 Author chain Z6； PDBConstruct 1–289； UniProt 1–289 Author chain Z7； PDBConstruct 1–289； UniProt 1–289

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q31RG2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG2_SYNE7
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 02； PDBConstruct 1–67； UniProt 1–67 Author chain Y2； PDBConstruct 1–67； UniProt 1–67 Author chain Z2； PDBConstruct 1–67； UniProt 1–67 Author chain z2； PDBConstruct 1–67； UniProt 1–67

ApcG

OrganismNot specified

UniProt Q31RM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RM8_SYNE7
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 12； PDBConstruct 1–110； UniProt 1–110 Author chain b2； PDBConstruct 1–110； UniProt 1–110

Allophycocyanin, beta subunit

OrganismNot specified

UniProt Q31RG1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG1_SYNE7
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A2； PDBConstruct 1–161； UniProt 1–161 Author chain B2； PDBConstruct 1–161； UniProt 1–161 Author chain C2； PDBConstruct 1–161； UniProt 1–161 Author chain F2； PDBConstruct 1–161； UniProt 1–161 Author chain K2； PDBConstruct 1–161； UniProt 1–161 Author chain L2； PDBConstruct 1–161； UniProt 1–161 Author chain M2； PDBConstruct 1–161； UniProt 1–161 Author chain O2； PDBConstruct 1–161； UniProt 1–161 Author chain T2； PDBConstruct 1–161； UniProt 1–161 Author chain V2； PDBConstruct 1–161； UniProt 1–161 Author chain X2； PDBConstruct 1–161； UniProt 1–161 Author chain a2； PDBConstruct 1–161； UniProt 1–161 Author chain c2； PDBConstruct 1–161； UniProt 1–161 Author chain d2； PDBConstruct 1–161； UniProt 1–161 Author chain g2； PDBConstruct 1–161； UniProt 1–161 Author chain l2； PDBConstruct 1–161； UniProt 1–161 Author chain m2； PDBConstruct 1–161； UniProt 1–161 Author chain n2； PDBConstruct 1–161； UniProt 1–161 Author chain p2； PDBConstruct 1–161； UniProt 1–161 Author chain u2； PDBConstruct 1–161； UniProt 1–161 Author chain w2； PDBConstruct 1–161； UniProt 1–161 Author chain y2； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin alpha chain

OrganismNot specified

UniProt Q31RG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RG0_SYNE7
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain D2； PDBConstruct 1–161； UniProt 1–161 Author chain E2； PDBConstruct 1–161； UniProt 1–161 Author chain G2； PDBConstruct 1–161； UniProt 1–161 Author chain H2； PDBConstruct 1–161； UniProt 1–161 Author chain I2； PDBConstruct 1–161； UniProt 1–161 Author chain J2； PDBConstruct 1–161； UniProt 1–161 Author chain Q2； PDBConstruct 1–161； UniProt 1–161 Author chain R2； PDBConstruct 1–161； UniProt 1–161 Author chain U2； PDBConstruct 1–161； UniProt 1–161 Author chain W2； PDBConstruct 1–161； UniProt 1–161 Author chain e2； PDBConstruct 1–161； UniProt 1–161 Author chain f2； PDBConstruct 1–161； UniProt 1–161 Author chain h2； PDBConstruct 1–161； UniProt 1–161 Author chain i2； PDBConstruct 1–161； UniProt 1–161 Author chain j2； PDBConstruct 1–161； UniProt 1–161 Author chain k2； PDBConstruct 1–161； UniProt 1–161 Author chain r2； PDBConstruct 1–161； UniProt 1–161 Author chain s2； PDBConstruct 1–161； UniProt 1–161 Author chain v2； PDBConstruct 1–161； UniProt 1–161 Author chain x2； PDBConstruct 1–161； UniProt 1–161

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q31RF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Allophycocyanin, beta subunit × 2 （O50209） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RF9_SYNE7
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N2； PDBConstruct 1–705； UniProt 1–705 Author chain o2； PDBConstruct 1–705； UniProt 1–705

Allophycocyanin, beta subunit

OrganismNot specified

UniProt O50209

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin alpha-B chain × 2 （Q31RP7） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O50209_SYNE7
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P2； PDBConstruct 1–169； UniProt 1–169 Author chain q2； PDBConstruct 1–169； UniProt 1–169

Allophycocyanin alpha-B chain

OrganismNot specified

UniProt Q31RP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Phycobilisome rod-core linker polypeptide × 6 （Q31LK9） C-phycocyanin alpha subunit × 72 （P13530） C-phycocyanin beta subunit × 72 （P06539） Phycobilisome rod linker polypeptide × 6 （Q31PE0） Phycobilisome rod linker polypeptide × 6 （Q31PD9） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 4 （Q31RG2） ApcG × 2 （Q31RM8） Allophycocyanin, beta subunit × 22 （Q31RG1） Allophycocyanin alpha chain × 20 （Q31RG0） Phycobiliprotein ApcE × 2 （Q31RF9） Allophycocyanin, beta subunit × 2 （O50209） PHYCOCYANOBILIN × 252	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q31RP7_SYNE7
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain S2； PDBConstruct 1–163； UniProt 1–163 Author chain t2； PDBConstruct 1–163； UniProt 1–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9wg7
Deposition date deposition_date	2025-08-23
Structure title title	The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942
Keywords keywords	PBS, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9wg7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9wg7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9wg7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	129.60 Å
Total Rg	129.50 Å
Atom count	287122
Residues	36628
Excluded volume	5102600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9wg7__assembly_1__model_1`	216-meric （216）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Phycobilisome rod-core linker polypeptide
Molecular weight formula_weight	28372.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,22,32,42,52,A6
Atom count atom_count	287122

MALPLLNYAPTTQNSRVAGFEVPGDEQPKQYNTEDQYSPVQFDEVIQAAYRQIFFHAFKCDRQTVLESQLRNGQITVRDFIRGLLLSATFRSSFYDKNSNYRFVEQVVQRVLGRDVYGEREKIAWSLAVATQGYEGFIDTLLNSDEYLSNFGYDKVPYQRRRVLPGRALGETPFNIKSPRYDSYYRTILGFPKAVFAGGPGKRFPAQYLSAKAGDPGAYLALARSIGARGQALSASADIDYLSKVPYRKR

Entity 2 Entity 2 polymer

Description description	C-phycocyanin alpha subunit
Molecular weight formula_weight	17303.2 kDa
Source method src_method	nat
Copy count entity_count	72

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;B1,F1,G1,H1,I1,K1,N1,R1,S1,T1,U1,W1,B3,F3,G3,H3,I3,K3,N3,R3,S3,T3,U3,W3,B4,F4,G4,H4,I4,K4,N4,R4,S4,T4,U4,W4,B5,F5,G5,H5,I5,K5,N5,R5,S5,T5,U5,W5,B6,F6,G6,H6,I6,K6,N6,R6,S6,T6,U6,W6,B7,F7,G7,H7,I7,K7,N7,R7,S7,T7,U7,W7 ;

MSKTPLTEAVAAADSQGRFLSSTELQVAFGRFRQAASGLAAAKALANNADSLVNGAANAVYSKFPYTTSTPGNNFASTPEGKAKCARDIGYYLRIVTYALVAGGTGPIDEYLLAGLDEINKTFDLAPSWYVEALKYIKANHGLSGDSRDEANSYIDYLINALS

Entity 3 Entity 3 polymer

Description description	C-phycocyanin beta subunit
Molecular weight formula_weight	18287.7 kDa
Source method src_method	nat
Copy count entity_count	72

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;C1,D1,E1,J1,L1,M1,O1,P1,Q1,V1,X1,a1,C3,D3,E3,J3,L3,M3,O3,P3,Q3,V3,X3,a3,C4,D4,E4,J4,L4,M4,O4,P4,Q4,V4,X4,a4,C5,D5,E5,J5,L5,M5,O5,P5,Q5,V5,X5,a5,C6,D6,E6,J6,L6,M6,O6,P6,Q6,V6,X6,a6,C7,D7,E7,J7,L7,M7,O7,P7,Q7,V7,X7,a7 ;

MTFDAFTKVVAQADARGEFLSDAQLDALSRLVAEGNKRIDTVNRITGNASSIVANAARALFAEQPSLIAPGGNAYTNRRMAACLRDMEIILRYVTYAVFTGDASILDDRCLNGLRETYLALGVPGASVAEGVRKMKDAAVAIVSDRNGITQGDCSAIISELGSYFDKAAAAVA

Entity 4 Entity 4 polymer

Description description	Phycobilisome rod linker polypeptide
Molecular weight formula_weight	30420.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y1,Y3,Y4,Y5,Y6,Y7

MTSLEAARRLGFSAYSESAPLEWRAGASSDEINAIIRAVYRQVLGNDYVMGTERLTSAESLLRGGEISVRDFVRAVALSELYREKFFHNNAHNRFIELNFKHLLGRAPYDQAEVAAHAATYHSHGYDADINSYIDSAEYTESFGDNVVPYFRGFATIRAQKTVGFNRIFQLYRGYATSDRSATSQRSRLDQEVARNAASPVLIGSTDSALVGTCGGSRDQLFRVQVQQQGVTARTSNRIRRSNATYFVSYEKLNATLQRVHAQGGRIVSITPA

Entity 5 Entity 5 polymer

Description description	Phycobilisome rod linker polypeptide
Molecular weight formula_weight	31734.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z1,Z3,Z4,Z5,Z6,Z7

MAITVASSRLGTAPFSNAAPVELRPDGDRDQVQAVIRAVYRQVLGNDYIMKSERLTAAESLLVNGSISVRDFVRAVAKSELYKTKFFYNNFQTRVIELHCKHLLGRAPYSEAEVIEHLDRYETQGYDADVDSYIDSSEYLETFGESIVPYYRDIEYHVGQQSVGLPRLFSLYRGYATSDRTSLGGNNSRLAANLAAKSVAPVVAPSVGTNYVASTKGEAPMRALGGSTPFGQTASRIFRVEIAAISKPGFPSVRRSNRSLLVPYEQLNNTLQQVNRSGGRVVSVAPASL

Entity 6 Entity 6 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7821.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	02,Y2,Z2,z2

MRMFRITACLPSPSKIRTQRELQNTFFTKLVPYDAWFREQQRIQKLGGKIIKVELATGRPNTNTGLL

Entity 7 Entity 7 polymer

Description description	ApcG
Molecular weight formula_weight	11365.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	12,b2

MVLDKLFGKKEKFFLEIDSSAASTETAAVETAVTPVAAAVETPTAAAGVATPEPAATPAPEPVAEETPAKEIPNVTFAADLSVPTINTGRRLPGPSLDPFVQIASEVVRR

Entity 8 Entity 8 polymer

Description description	Allophycocyanin, beta subunit
Molecular weight formula_weight	17408.7 kDa
Source method src_method	nat
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,B2,C2,F2,K2,L2,M2,O2,T2,V2,X2,a2,c2,d2,g2,l2,m2,n2,p2,u2,w2,y2

MQDAITAVINASDVQGKYLDSSALDRLKSYFQSGELRVRAAATISANSALIVKEAVAKSLLYSDITRPGGNMYTTRRYAACIRDLEYYLRYATYAMLAGDTSILDERVLNGLKETYNSLGVPIGATVQAIQAIKEVTASLVGPDAGREMGVYLDYISSGLS

Entity 9 Entity 9 polymer

Description description	Allophycocyanin alpha chain
Molecular weight formula_weight	17439.7 kDa
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D2,E2,G2,H2,I2,J2,Q2,R2,U2,W2,e2,f2,h2,i2,j2,k2,r2,s2,v2,x2

MSIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLGTPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS

Entity 10 Entity 10 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	78910.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N2,o2

MTVTASGGSSLARPQLYQTVPGSTIVQAEQQDRFPQQGELRELSSYFQSGLKRLAIAEIITRNSDTIVSRAANRIFVGGSPLAYIERPKVDPRNLRSAEEQRAREAKLGTVTFVESSGGGGFFSGLTAALGGAGAVRIPSGFRPINVARYGPRNMQKSLRDMSWFLRYITYAIVAGDPNILVVNVRGLREIIEKACSTPATLVALQDMRATSAGYFRNDPEAQQLVKDYFDVLIREFEAPTPSLKQRQRFAEDQQGLALPQSYANAAERRPKFVIKSTLSTVEKNEAIKAAYRQVFERDITRAYSQKVSDLESKVKNGEISTKEFIRRLGKSPLYRQQFHDRFVNSRVIELAFRHFLGRGISSAEEFTRYFDLLSAKGFAALIDALVDSQEYADYFGEETVPYLRGLGQEAQECRNWGVQQELFKYSAPFVKVPQFVTLFGEYKQPLLDQHPYGAGNDPLEIQFGAIFPSRTVNNRTNPAPFGKDTRRLLVSKGGVNNQVGSAAFQQSGTTPTKIFKLTQVAAGSSSIRSKSVGNPSIRQTESTTQAVIRAAYRQVFGRDLYEGQRLTVPEIKLENGEITVREFVRQIAKSETFRKLYWNNLYVVKAVEYIHRRLLGRPTTGRAEINAYFDISAKKGFYALVDAILDSPEYIAAFGEDTVPYERYITPKGLALRSVRGLEASEKVKASLRPAAGAQERRPEVGRR

Entity 11 Entity 11 polymer

Description description	Allophycocyanin, beta subunit
Molecular weight formula_weight	18590.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P2,q2

MRDAVSSLIAGYDLAGKYLDRNAVDSLRAYFAEGNARVQAAEIINANAASLVRDASAQLFEEVPELLRPGGNAYTTRRYSACLRDLDYYLRYATYALVAGNTEVLDERVLQGLRETYTSLGVPSGPTVRGIAILRDRVRQLVEQAGISNAAFVEVPFDHLGRNLAEQDI

Entity 12 Entity 12 polymer

Description description	Allophycocyanin alpha-B chain
Molecular weight formula_weight	18149.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S2,t2

MTIVSQVILKADDELRYPSGGELKNITDFFKTGEQRLRIAQVLSDSEKKIVDQASRKLWQRRPDFIAPGGNAYGQRQRAQCLRDYGWYLRLITYGVLAGDKEPIESIGLLGAREMYNSLGVPLPGMAEAIRTLKEASLALLSSADATVAAPYFDFLIQGMETI

Entity 13 Entity 13 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	252

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	258722

The structure of phycobilisome with a bicylindrical core from the cyanobacterium Synechococcus elongatus PCC 7942

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome rod-core linker polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod linker polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod linker polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ApcG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin, beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer