9wyp

The PSI-ACPI supercomplex from the cryptophyte Chroomonas placoidea

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AIB4_9CRYP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–752； UniProt 1–752

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt A0A222AI95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI95_9CRYP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt A0A222AI25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI25_9CRYP
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt A0A222AIA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AIA6_9CRYP
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt A0A222AIF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AIF3_9CRYP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain E； PDBConstruct 1–64； UniProt 1–64

Photosystem I reaction center subunit III

OrganismNot specified

UniProt A0A222AI52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI52_9CRYP
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain F； PDBConstruct 1–183； UniProt 1–183

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A0A222AI78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI78_9CRYP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt A0A222AI55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI55_9CRYP
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit PsaK

OrganismNot specified

UniProt A0A222AI34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit XI × 1 （A0A222AI68） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI34_9CRYP
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain K； PDBConstruct 1–87； UniProt 1–87

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt A0A222AI68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XII × 1 （A0A222AI28） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI68_9CRYP
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain L； PDBConstruct 1–153； UniProt 1–153

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt A0A222AI28

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	ACPI-1 × 1 ACPI-2 × 1 ACPI-3 × 1 ACPI-4 × 1 ACPI-5 × 1 ACPI-6 × 1 ACPI-7 × 1 ACPI-8 × 1 ACPI-12 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A222AIB4） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A222AI95） Photosystem I iron-sulfur center × 1 （A0A222AI25） Photosystem I reaction center subunit II × 1 （A0A222AIA6） Photosystem I reaction center subunit IV × 1 （A0A222AIF3） Photosystem I reaction center subunit III × 1 （A0A222AI52） Photosystem I reaction center subunit VIII × 1 （A0A222AI78） Photosystem I reaction center subunit IX × 1 （A0A222AI55） Photosystem I reaction center subunit PsaK × 1 （A0A222AI34） Photosystem I reaction center subunit XI × 1 （A0A222AI68） PsaO × 1 PsaR × 1 CCPI-S × 1 ACPI-13/10 × 2 ACPI-14 × 1 ACPI-9 × 1 ACPI-11 × 1 PsaQ × 1 CHLOROPHYLL A × 255 Chlorophyll c2 × 20 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ; × 59 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 4 ;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ; × 12 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 33 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene × 25 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 IRON/SULFUR CLUSTER × 3 PHYLLOQUINONE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A222AI28_9CRYP
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain M； PDBConstruct 1–30； UniProt 1–30

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9wyp
Deposition date deposition_date	2025-09-27
Structure title title	The PSI-ACPI supercomplex from the cryptophyte Chroomonas placoidea
Keywords keywords	PHOTOSYNTHESIS, STRUCTURAL PROTEIN; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9wyp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9wyp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9wyp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.84 Å
Rg (electron density)	65.74 Å
Total Rg	65.73 Å
Atom count	61306
Residues	5239
Excluded volume	1155400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9wyp__assembly_1__model_1`	29-meric （29）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	ACPI-1
Molecular weight formula_weight	23479.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	61306

MLRLSLLAAIVACASAFAPTSLPMGSMRKAATKGPSMQLFGAGKLQGEGVTAIPFAGRPKTPAFDGTWAGDTGFDPLTISAWLDIRFLREAELKHCRVAMLAAAGAIAQDAFTFPGTVETFGTGKMTALHDAAVKTGTMGQMLVWIGFAEIFSTAAILQWYTDGSTRKPGDFGFDPLGFSKGKDAARLELCELKNGRLAMIAIGGMIHHYLITGKGPLELLP

Entity 2 Entity 2 polymer

Description description	ACPI-2
Molecular weight formula_weight	23400.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MLRVALIAAILASASAFAPMGSLGLVKSARSGAAISPRMQSGDFSAAVPFLKRPSNLDGTLAGDVGFDPLGFSDVFDLRVLREAELKHGRFAMLAVLGFLVQEVYTFPFFPKMAPVDAHDYFVTQGGGSQIIFWISFVEIFGVVALFELIQGKRDAGDFAFDPLGLGKDEATLARYKVAEIKHARLAMIAIGGFIHQFWVTKQTVLEQLGNFQSLA

Entity 3 Entity 3 polymer

Description description	ACPI-3
Molecular weight formula_weight	24853.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLRTLALLAAVASASAFTAAPMLSTSTRAKAVSSVSGMRMQEKSASVPFLSKPEKLDGSMAGDVGFDPLGISYFIDVKWLREAELKHGRICMLATAGILVQEVIHLPGPAFSSKFALDAWSTAPRGGMVQILIAIGLIEMVSNRFAITATDMFANPNRKPGDLGFDPLSLGANPATRAKYELSEVIHGRAAMMGLSGMIHQMIVSKQPVIDQLLNFKPVDASFKLGGAAGTMGMG

Entity 4 Entity 4 polymer

Description description	ACPI-4
Molecular weight formula_weight	23548.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MLRSLALLCLVGAASAFAPGAAPLVRSNTRAAIARGPRMQEMSKAIPFAERPAKLDGKIPGDVGFDPLGFSDYYDLKYLREAEIKHGRICMLGALGWLFPEFAKLPQFASLSTNPLKAATELGPAGWAQIFIFVGALESFSYEKIYYGDSAPGDLGFDPLRLGKNPVSRAHYEVAEIKNGRLAMIGLGGMIHHSLLTKQGAIEQIMSQNFYPSGFPQ

Entity 5 Entity 5 polymer

Description description	ACPI-5
Molecular weight formula_weight	24055.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MLRLSLLAACIAAASAFAPVALPGMGMRAATRRPAVSMQLWEDGKVQGKGLKAIPFSDPPESLPSDMVGYVGFDPLGFSTLFDIKFLREAELKHGRAAMLAAAGAIAQDIFTFPGVTSVIGDAKMTGAHDAFLKAAADGNPKANAMSQLFVWIGFFELVSMPALFETLNGGERAPGDFYFDPLGLGKGSGRARMELAEIKNGRLAMIGIGGMVHHYLLTGKGPIGTIVG

Entity 6 Entity 6 polymer

Description description	ACPI-6
Molecular weight formula_weight	22688.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MLRVALISALVASASAFAPTALPAARASARAVSAGPKMQMSPSVPFLKRPVALDGSMVGDVGFDPLGLSSVGDIKFLREAELKHCRLAMLAAAGSMAQDLYTFPGVDKVIGDAKMTAVHDKLVSQGAMGQLLVWIGFAEVFATMALFETLDGKRAPGDFKFDPLGFGKNPEALKRYQLAEIKNGRLAMLGFGGMVHGYFVTGKGPLELLTNFQAA

Entity 7 Entity 7 polymer

Description description	ACPI-7
Molecular weight formula_weight	24550.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MLRVALLSALVASAAAFTAPAALFKAPTRSSRAMSVKMQDNSAAVPFLSRPAALDGSMVGDVGFDPLGFTGKYDLKWLREAELKHGRVAMLASLGCLVQEFIHLPFEATSNPVASEAFFQVPSGGLWQIFTVIGVIEHVSNGFNMSGSTMFKSGRAPGNLGFDPLNFGKNPTARARYELAELKNGRLAMLGFAGMIHGCFITGKGPLAALTSLDWHQQIGRASCRERVGC

Entity 8 Entity 8 polymer

Description description	ACPI-8
Molecular weight formula_weight	23700.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MFARTLLLAACAASASAFAPGSFAPMGLRGSTAAVSRPMARAGLSSVSMAANPMTNAIEEFAESAPELASRGLGVTTNAERWNGRHAMFGIFAIVMTAYFKGHGLIPDAEKILDVNQWGPLASAGQGQGITNERAIILIAHVHVLVVSVLAAFAPFQFQDTLVKEKGYTPEAPAGIIPPFKTGLTPEAELINGRLAMLGVISIIMASIFTGNSVIDVVNLGLGKILF

Entity 9 Entity 9 polymer

Description description	ACPI-12
Molecular weight formula_weight	23223.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MFRALLVLAAVAGASAFTAPAVLPGRSTARAATKGPSMQLYKEGSLQGKGVNCIPIFKRPDSLKGDAVGDMGFDPFGFSSWVDMNYVREAEIKHGRIAMLAFAGIVVEVLGIKAPGAGKILGSSTDIFEIHNAAVEKGSMGQILLWCGFFEMTAGLPAMQQMLEGSGRTPGDFGFDPLGLGKKDFAQMQIKEIQNGRLAMLAVSGMVHHALINGKVQGLP

Entity 10 Entity 10 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83493.6 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MTVSSTEQEAKKVSITVDKDPVATSFEKWAQPGHFSRTLAKGPKTTTWIWNLHADAHDFDSHTSSLEDISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYSAWLSNPTAVKPSAQVVWPIVGQEVLNGDVGGGFQGVQITSGFFQIWRASGITSEVELYWCALAGLLMSGLMIFAGWFHYHKAAPKLEWFQNAESMLNHHLSGLLGLGCLSWAGHQIHVSLPINKLLDAGVAPQEIPLPHEFLVNRDLMAQLYPSFSKGLVPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFIVAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEVLITSWHAQLSINLAMLGSLSIIIAHHMYAMPPYPYIATDYPTQLSLFTHHMWIGGFCVCGAAAHAGIFMVRDYNPAQNYNNLLDRVIRHRDAIISHLNWICIFLGFHSFGLYIHNDTMRALGRTQDMFSDTAIQLKPVFAQWVQNIHTVAPGNTTPNALATASYAFGGNVVSVGNKVAMMPISLGTADFMVHHIHAFTIHVTVLILLKGVLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQSSAWDSVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVQADNTVTHITGGNFAQSAITINGWLRDFLWAQASQVIQSYGSSLSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESVVWAHNKLNFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWAFFLARIISVG

Entity 11 Entity 11 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82219.8 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQALAQDPATRRIWYGLATAHDFESHDGMTEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFEQWVLNPLKVKPVAHAIWDPHFGQPAVKAFTKGGVFYPVNIATSGVYHWWYTIGMRTNNDLYAGSLFLLFLSGVFLFAGWLHLQPKFRPGLSWFKNNESRLNHHLSGLFGFSSLAWAGHLIHIAIPEARGQHVGWDNFTKTLPHPAGLTPFFTGNWSLYADNPDTANHIFGTSEGSGSAILTFLGGFHPQTQALWLTDIAHHHLAIGVVFIFAGHMYRTNWGIGHSLKEILDAHRPPGGRLGAGHKGLFETITNSLHFQLGLALASIGVITSLVAQHMYALPAYAFIAKDYTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPEQNKNNVLARMLEHKEAIISHLSWVSLFLGFHTLGLYIHNDVVVAFGTPEKQILVEPVFAQWIQASSGKALYGFDVLLSSSNSVATNASNNIWLPGWLDAINSGKNSLFLPIGPGDFLVHHAIALGLHTTALILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLSMFWMLNTIGWVTFYWHWKHVTIWQGNAGQFNESSTYIMGWLRDYLWLNSSPLINGYNPFGMNSLAVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLAWAHERTPLANLVRWKDKPVALSIVQARLVGLIHFTVGYVFTYAAFVIASTTGKFG

Entity 12 Entity 12 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8743.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHAVKVYDTCIGCTQCVRACPCDVLEMVSWDGCKAGQIASAPRTEDCIGCKRCETACPTDFLSVRVYLGGETTRSMGLAY

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15590.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSETLNLQIPSPTFEGSTGGWLRAAEVEEKYAITWTSGKEQVFEMPTGGAAIMRKGENLLYLARKEQCLALGTQLKTGFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVNAGRIGVGNVSHSIGKNLNPSQIKFTNKSFNG

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7352.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVKRGSQVRILRKESYWYQDVGTVATIDTSGIRYPVVVRFEKVSYSGVNTNNFSLDEVVEVVKK

Entity 15 Entity 15 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	20393.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKNWVSLVLIFSIVTTPYVAHADVAGLTPCKDSKDFQRRLDGSVKKLKTRLAKYEKGTPPALALEKQIERTQARFERYGKAGLLCGTDGLPHLITDGRWSHSGEFVIPGLFFLYIAGWIGWVGRSYVLFARESDKPTEKEIILDVPAALSFVSTGFIWPVSAFKEFTSGNLIADESEITVSPR

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3975.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTAAYLPSILVPLIGLIFPGFVMGFAFIYIEQEEIA

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4862.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MDSNFLKYLSTAPVLLTVWLSFTAGLVIEANRFFPDMLYFPM

Entity 18 Entity 18 polymer

Description description	Photosystem I reaction center subunit PsaK
Molecular weight formula_weight	8836.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNADLLLAVVPQTAAWSAKTCSVMVISNLLCIVAGRYVIQVKGSGPSLPLTGSFSNFGLPELLATTSLGHIVGSGAILGLSYVGLLS

Entity 19 Entity 19 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16490.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAQFVKPYNDDPFVGNLATPVSTSSFTRSFLSNLPAYRSGLSPLLRGLEIGMTHGYFLVGPFYKLGPLRNSDVALISGLFSSIGLIIILAACLAIYGVVSFNEDDNTDSLQTSRGWKQFTSGWLVGSIGGASFAYILISNIVFLQTSGLNLIK

Entity 20 Entity 20 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3248.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MISDTQIFVALILALVSLVLAIRLGTALYQ

Entity 21 Entity 21 polymer

Description description	PsaO
Molecular weight formula_weight	16384.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MMKVAFLVLLAAATANAFAPTAAFLPKAHGIAASKPAMALRAAPRAVAKPLAVQAKFEISDGVEFDLNPLVLAISFLGWSLPGLLPSNIPLYGGKGLTTALFAEIGEHLQTFPAPPPIGDPFWVILFIWHSGLFATMIFGTIGYNGYGPKSTTKY

Entity 22 Entity 22 polymer

Description description	PsaR
Molecular weight formula_weight	14468.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

NSSPSKMVRALCFLALIASAAAFSTAPGLALRSSVRPATSTKTPMKMAGYSPVPSPDNTKETYWETKAPSSQVLGIGKDVSSGNYIVASVVAAVVGAACTGQCIPLTVSPNPVFILGSFLLPYSWALHVAAWIQRNNGK

Entity 23 Entity 23 polymer

Description description	CCPI-S
Molecular weight formula_weight	29319.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

VKTAALVLLGAAVAEAFAPTPVALNRPGRADAVTSLRMAQAAPPSKLPENMAKKNALKVNKEQWGIEEAIKVDAKAAAPAPKAAAPAPKKAAPKKGAAPAEATVGFSGVPSDFCRPAPTAFPAEPAGMTVFGARGPRAEGHRDKFGSRHAAVSLACAALLWQPISQAGMYSIDSGSLAKKSFSEMEVPGFGDAKKVPTIESFFPFTKNGFDASPALFGKDSMIVFENPLGKCGAYASSCHTFLDEMGDMLKATPQEMPRSKAAPTYSFPWMYDHAAWKK

Entity 24 Entity 24 polymer

Description description	ACPI-13/10
Molecular weight formula_weight	22271.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,d

MIRAVILAGCVAAASAFAPGASLVGARAATRAVSAAGPKMQMSPSIPFLKKPDALDGTAAGDIGFDPLGFSSLADIKFLQEAEIKHCRIAMLAAAGSIAQDIFTFPGYSALTGGAKMTAAHDKLVATGTMGQILFWVSFAEVFGTVALFDTLDGKRAPGDFKFDPLGMGKKNMADMQLKEIKNGRLAMLGIAGMTHGYFISGKGPLELLGNFPTA

Entity 25 Entity 25 polymer

Description description	ACPI-14
Molecular weight formula_weight	23755.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MFRAALLLACLASASAFAPGSLMMPKSATRAAISRGPRMQANDDLAVPFLERPPMLDGSYAGDIGFDPVGFSNYFDLRWLREAELKHGRVCMLGVVGFLVQEFVTLPMFSNGVTPVDDFFVVPATGLWQIFFTIGFVEAFSNGFKLTPSDMFADDRAPGDLGFDPLGCGKDPAALARRQLVEVKNGRLAMIAFGGMLHQQLLTKQGVIEQLTNFKAIM

Entity 26 Entity 26 polymer

Description description	ACPI-9
Molecular weight formula_weight	27212.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MFRLSILAALVAAASAFAPGAMLPQGRAVARASAASGIRMQSKSAAIPFLEKPPMLDGSVPGDVGFDPLWVSSMLPDKGWYLFLQEAEIKHGRVAMLAAAGAIVQDIFTFPGVTDTIGNVKMTSAHDKFLSMEGAGGKVATMHQLLLWLGLLEVVSAFATIQMFGGTSSRMPGEFGFDPLGFGKSEAAMKTYRLKEVKNGRLAMIGIGGMVHHYLLTGKGPLQFLGGIPNYKSCIEHPASGLPYLMKAVGPVLPKIC

Entity 27 Entity 27 polymer

Description description	ACPI-11
Molecular weight formula_weight	22451.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MLRTVAILACLASASAFAPLASLPMTGTRATKAVGPRMQEQMAVPFLQPPSKLSSSMQGYAGFDPLGFSEKFDVNWLREAEIKNGRVAMLGVVGLLIPEFITLPMYSAGATPYDSAFTVPAWALIQITLGCGAAEYYMHKGKMTPDNMFDGSRAPGDFGWGKADPVMATKEIKNGRLAMLAFGGIMHQQLITKMGTFAHLVDFKPLVF

Entity 28 Entity 28 polymer

Description description	PsaQ
Molecular weight formula_weight	24466.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

AIFALGLACADAFHTPALNGVIGARMGAETPAISRKQLLQGAAGVAVGFLANQGAEAASFDPNTGFPKQDGKKDLLCNGSADKGCQPMTQAASITDKQKAVLAGKITVAANKLSILDAEIAAMQVTKNKKKKPVLDTPYVLRYSALYLTPLVDAMEQYAARDAKGSKMAGGAGLPKMGNSDKDAAKASPLYKYITEANTAIAAVSTAAKAGDFAGVTTASAAVKAAATGFLGAAKAPVIFN

Entity 29 Entity 29 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	255

Entity 30 Entity 30 non-polymer

Description description	Chlorophyll c2
Molecular weight formula_weight	608.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 31 Entity 31 non-polymer

Description description	;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E})-3,7,12,16-tetramethyl-18-[(4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-3,5,7,9,11,13,15-heptaen-1,17-diynyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	59

Entity 32 Entity 32 non-polymer

Description description	;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(1~{R},4~{R})-2,6,6-trimethyl-4-oxidanyl-cyclohex-2-en-1-yl]octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	566.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 33 Entity 33 non-polymer

Description description	;(1~{R})-3,5,5-trimethyl-4-[(3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-(2,6,6-trimethylcyclohexen-1-yl)octadeca-3,5,7,9,11,13,15,17-octaen-1-ynyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 34 Entity 34 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	33

Entity 35 Entity 35 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 36 Entity 36 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 37 Entity 37 non-polymer

Description description	(6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	25

Entity 38 Entity 38 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 40 Entity 40 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.25 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	171764

The PSI-ACPI supercomplex from the cryptophyte Chroomonas placoidea

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer