SAXSdb — 9x1h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Complement C1s subcomponent heavy chain

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 16–292 Chain B； UniProt 16–292	Not recorded	RAY121 Fab Light chain × 2 RAY121 Fab Heavy chain × 2 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES(7.5), 150mM NaCl, 3mM CaCl2, 0.03% DDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X1H	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ELV CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF HUMAN COMPLEMENT C1S PROTEASE Deposited 2000-03-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 358–688（331 aa） Fragment：CCP2-SP CATALYTIC FRAGMENT: ASP363-ASP-673 SEGMENT PRECEDED BY AN ASP-LEU SEQUENCE ADDED AT THE N-TERMINAL END	Mutation：YES	SO4 SULFATE ION × 2 NES 2-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；277 K；PEG 4K 34%, AMMONIUM SULFATE 100mM, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.70 Å R-free 0.219
1NZI Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s Deposited 2003-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 16–174（159 aa） Fragment：CALCIUM-DEPENDENT INTERACTION DOMAIN Chain B 16–174（159 aa） Fragment：CALCIUM-DEPENDENT INTERACTION DOMAIN	Not recorded	CA CALCIUM ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；PEG 4000, magnesium chloride, glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.50 Å R-free 0.234
4J1Y The X-ray crystal structure of human complement protease C1s zymogen Deposited 2013-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 292–688（397 aa） Fragment：CCP1-CCP2-SPz (UNP Residues 292-698)	Mutation：Q436A, I438A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；18% PEG 3350, 0.2M potassium nitrate., pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.66 Å R-free 0.259
4J1Y The X-ray crystal structure of human complement protease C1s zymogen Deposited 2013-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 292–688（397 aa） Fragment：CCP1-CCP2-SPz (UNP Residues 292-698)	Mutation：Q436A, I438A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；18% PEG 3350, 0.2M potassium nitrate., pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.66 Å R-free 0.259
4J1Y The X-ray crystal structure of human complement protease C1s zymogen Deposited 2013-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 292–688（397 aa） Fragment：CCP1-CCP2-SPz (UNP Residues 292-698) Chain B 292–688（397 aa） Fragment：CCP1-CCP2-SPz (UNP Residues 292-698)	Mutation：Q436A, I438A Mutation：Q436A, I438A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；18% PEG 3350, 0.2M potassium nitrate., pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.66 Å R-free 0.259
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292) Chain D 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LMF C1s CUB1-EGF-CUB2 Deposited 2013-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292) Chain C 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	NA SODIUM ION × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.92 Å R-free 0.252
4LOR C1s CUB1-EGF-CUB2 in complex with a collagen-like peptide from C1q Deposited 2013-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 17–292（276 aa） Fragment：CUB1-EGF-CUB2 fragment (unp residues 17-292)	Not recorded	CA CALCIUM ION × 3 NA SODIUM ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 100 mM NaBr, 24% PEG 3350 , pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.252
4LOS C1s CUB2-CCP1 Deposited 2013-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 172–358（187 aa） Fragment：CUB2-CCP1 fragment (unp residues 172-358)	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；100 mM Tris/acetate, 200 mM KH2PO4 + 20% PEG 10K , pH 8, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.00 Å R-free 0.212
4LOT C1s CUB2-CCP1-CCP2 Deposited 2013-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 175–423（249 aa） Fragment：CUB2-CCP1-CCP2 fragment (unp residues 175-423)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；293 K；24% PEG 8K in Bis-tris propane-HCL, containing 200 mM potassium citrate, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.92 Å R-free 0.292
5UBM Crystal structure of human C1s in complex with inhibitor gigastasin Deposited 2016-12-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 437–688（252 aa） Chain B 285–436（152 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.1 M Bis-Tris, pH 5.5, 25 % PEG 3350	Resolution 2.50 Å R-free 0.222
6F1C C1rC1s complex Deposited 2017-11-21	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 16–292（277 aa） Chain D 16–292（277 aa）	Not recorded	CA CALCIUM ION × 12 NA SODIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；12-18% PEG 8000, 100 mM Imidazole at pH 8.0	Resolution 4.20 Å R-free 0.305
6F1H C1rC1s complex Deposited 2017-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 17–292（276 aa）	Not recorded	CA CALCIUM ION × 6 NA SODIUM ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；298 K；12-18% PEG 8000, 100 mM Imidazole at pH 8.0	Resolution 4.50 Å R-free 0.340
6F1H C1rC1s complex Deposited 2017-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 17–292（276 aa）	Not recorded	CA CALCIUM ION × 6 NA SODIUM ION × 3 LYS LYSINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；298 K；12-18% PEG 8000, 100 mM Imidazole at pH 8.0	Resolution 4.50 Å R-free 0.340
8GMN Crystal structure of human C1s in complex with inhibitor Deposited 2023-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 358–688（331 aa）	Not recorded	ZWK [4-(1-aminophthalazin-6-yl)piperazin-1-yl](2-methylphenyl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；22% PEG 3350, 50-100 mM Ammonium Sulphate and 100 mM TRIS pH 7.5-8.0	Resolution 2.60 Å R-free 0.281
8GMN Crystal structure of human C1s in complex with inhibitor Deposited 2023-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 358–688（331 aa）	Not recorded	ZWK [4-(1-aminophthalazin-6-yl)piperazin-1-yl](2-methylphenyl)methanone × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；22% PEG 3350, 50-100 mM Ammonium Sulphate and 100 mM TRIS pH 7.5-8.0	Resolution 2.60 Å R-free 0.281
8GMN Crystal structure of human C1s in complex with inhibitor Deposited 2023-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 358–688（331 aa）	Not recorded	ZWK [4-(1-aminophthalazin-6-yl)piperazin-1-yl](2-methylphenyl)methanone × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；22% PEG 3350, 50-100 mM Ammonium Sulphate and 100 mM TRIS pH 7.5-8.0	Resolution 2.60 Å R-free 0.281
8GMN Crystal structure of human C1s in complex with inhibitor Deposited 2023-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 358–688（331 aa）	Not recorded	ZWK [4-(1-aminophthalazin-6-yl)piperazin-1-yl](2-methylphenyl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；22% PEG 3350, 50-100 mM Ammonium Sulphate and 100 mM TRIS pH 7.5-8.0	Resolution 2.60 Å R-free 0.281
8TYP Complement Protease C1s Inhibited by 6-(4-phenylpiperazin-1-yl)pyridine-3-carboximidamide Deposited 2023-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 358–688（331 aa）	Not recorded	SQT 6-(4-phenylpiperazin-1-yl)pyridine-3-carboximidamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M sodium acetate 0.1 M Tris-HCl (pH 8.1) PEG-4000 24% (w/v)	Resolution 1.80 Å R-free 0.196
8W18 The crystal structure of the Michaelis-Menten complex of a C1s/C1-INH at 3.94 Angstroms Deposited 2024-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 292–437（146 aa） Fragment：Sushi domains Chain B 438–688（251 aa）	Mutation：S632A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.1 M L-Proline, 0.1M HEPES (pH 6.5), and 12% PEG 3,350	Resolution 3.94 Å R-free 0.281

13 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	C1S_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–277； UniProt 16–292 Author chain B； PDBConstruct 1–277； UniProt 16–292

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x1h
Deposition date deposition_date	2025-10-02
最后修订 last_revision	2025-11-19
Structure title title	Cryo-EM Structure of human complement C1s CUB domain in complex with RAY121
Keywords keywords	PH-DEPENDENT, RECYCLING ANTIBODY, IMMUNE SYSTEM, COMPLEMENT C1s, FAB, COMPLEX, CUB DOMAIN, EGF-LIKE DOMAIN; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	32.50 Å
Radius of gyration Rg (electron density) rg_electron	31.98 Å
Forward intensity I(0) i0	115037000.00
Molecular weight molecular_weight	83577.0 kDa
Excluded volume excluded_volume	103490 Å³
Envelope volume envelope_volume	134000 Å³
Hydration-shell volume shell_volume	35369 Å³
Envelope diameter envelope_diameter	110.7 Å
Shell Rg shell_rg	38.56 Å
Envelope Rg envelope_rg	31.33 Å
Shape Rg shape_rg	31.96 Å
Total Rg total_rg	32.59 Å
Total atoms total_atoms	5888
Residues n_residues	754
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	106.0 Å
Rg (real space) rg_real	32.52 Å
Rg uncertainty (real space) rg_real_error	0.79 Å
I(0) (real space) i0_real	1.1500e+08
I(0) uncertainty (real space) i0_real_error	1.7880e+06
Rg (reciprocal space) rg_reciprocal	32.52 Å
I(0) (reciprocal space) i0_reciprocal	115000000.0000
Solution quality estimate total_estimate	0.8943
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.6 Å
Skewness Skewness skewness	0.292
Kurtosis Kurtosis kurtosis	-0.487
Angular range angular_range	— – 0.2450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14310000.0000
Real-space data points n_real_points	50
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.929; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.983; Smooth: 0.853

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	RAY121 Fab Light chain
Molecular weight formula_weight	24034.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M
Atom count atom_count	5888

DIQMTQSPSSLSASVGDRVTITCQAHEILHDKKNLAWYQQKPGQPPKLLIYSASILESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCHGEFSHGSGDLNHFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	RAY121 Fab Heavy chain
Molecular weight formula_weight	24044.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,H

QVQLVESGGGVVQPGRSLRLSCAASGFTFSAYAMNWIRQPPGKGLEWIGLIYGSGHEFYASWAEERVTISVDTSKNQFSLKLSSVTAADTAVYYCARGRSKNYNSDFHLWGQGTLVTVSSASTKGPSVFPLAPSSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Complement C1s subcomponent heavy chain
Molecular weight formula_weight	32556.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A

EPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMGGGGSDYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	1101481

fit	/app/data/saxs_computation/x1/9x1h/9x1h.fit
pddf	/app/data/pr_computation/x1/9x1h/9x1h.pr.out
profile	/app/data/saxs_computation/x1/9x1h/9x1h.dat

Cryo-EM Structure of human complement C1s CUB domain in complex with RAY121

1. Protein Identity and Related Structures Protein Identity & Related Structures

Complement C1s subcomponent heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)