← Back to search

9x43

Crystal structure of glycosyltransferase UGT73C1 in complex with UDP and quercetin

Method: X-RAY DIFFRACTION D_max: 73.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x43
deposition_date	2025-10-10
last_revision	2026-04-29
title	Crystal structure of glycosyltransferase UGT73C1 in complex with UDP and quercetin
keywords	UDP-glycosyltransferase, GT-B fold, di-O-glycoside synthesis, Quercetin, PLANT PROTEIN; PLANT PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.00 Å
rg_electron	21.83 Å
i0	48395000.00
molecular_weight	54737.0 kDa
excluded_volume	68769 Å³
envelope_volume	79111 Å³
shell_volume	29003 Å³
envelope_diameter	75.3 Å
shell_rg	29.81 Å
envelope_rg	22.08 Å
shape_rg	21.84 Å
total_rg	22.71 Å
total_atoms	3844
n_residues	480
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	73.1 Å
rg_real	22.86 Å
rg_real_error	0.37 Å
i0_real	4.8390e+07
i0_real_error	6.5740e+05
rg_reciprocal	22.90 Å
i0_reciprocal	48400000.0000
total_estimate	0.8898
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	29.2 Å
skewness	0.183
kurtosis	-0.381
angular_range	— – 0.3450 Å⁻¹
current_alpha	0.0000
highest_alpha	15220000.0000
n_real_points	66
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.860; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.986; Smooth: 0.997

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	UDP-glycosyltransferase 73C1
formula_weight	54860.9 kDa
ec_number	2.4.1.-
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3934

MHFVLFPFMAQGHMIPMVDIARLLAQRGVTITIVTTPQNAGRFKNVLSRAIQSGLPINLVQVKFPSQESGSPEGQENLDLLDSLGASLTFFKAFSLLEEPVEKLLKEIQPRPNCIIADMCLPYTNRIAKNLGIPKIIFHGMCCFNLLCTHIMHQNHEFLETIESDKEYFPIPNFPDRVEFTKSQLPMVLVAGDWKDFLDGMTEGDNTSYGVIVNTFEELEPAYVRDYKKVKAGKIWSIGPVSLCNKLGEDQAERGNKADIDQDECIKWLDSKEEGSVLYVCLGSICNLPLSQLKELGLGLEESQRPFIWVIRGWEKYNELLEWISESGYKERIKERGLLITGWSPQMLILTHPAVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFCNEKLAVQILKAGVRAGVEESMRWGEEEKIGVLVDKEGVKKAVEELMGDSNDAKERRKRVKELGELAHKAVEEGGSSHSNITFLLQDIMQLEQHHHHHH

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Escherichia coli

Entity 2 non-polymer

description	URIDINE-5'-DIPHOSPHATE
formula_weight	404.2 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	3,5,7,3',4'-PENTAHYDROXYFLAVONE
formula_weight	302.2 kDa
src_method	nat
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	90

▶

6. Citations (1)

▶

length_a	85.465 Å
length_b	88.253 Å
length_c	132.045 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	I 2 2 2
int_tables_number	23
crystal_system	—

resolution	2.081 Å
resolution_low	61.395 Å
r_factor	0.2108
r_work	0.2083
r_free	0.2537

fit	/app/data/saxs_computation/x4/9x43/9x43.fit
pddf	/app/data/pr_computation/x4/9x43/9x43.pr.out
profile	/app/data/saxs_computation/x4/9x43/9x43.dat