SAXSdb — 9x47

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein

Streptococcus thermophilus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–579	Not recorded	Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein × 1 （Q5M4V7）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X47	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9X46 Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with ADP Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.25 Å
9X48 Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 2 Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.26 Å
9X49 Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 3 Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.34 Å
9X4A Cryo-EM structure of Streptococcus thermophilus FoeAB E504Q mutant in complex with ATP Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.16 Å
9X4B Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with ATP and ADP Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.84 Å
9X4C Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with AMPPNP in peptidisc Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.08 Å
9XKA Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with AMPPNP Deposited 2025-11-05	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–579（579 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5M4V8_STRT2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–579； UniProt 1–579

Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein

Streptococcus thermophilus

UniProt Q5M4V7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 42–623	Not recorded	Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein × 1 （Q5M4V8）	ELECTRON MICROSCOPY mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9X47	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9X46 Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with ADP Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.25 Å
9X48 Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 2 Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.26 Å
9X49 Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 3 Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.34 Å
9X4A Cryo-EM structure of Streptococcus thermophilus FoeAB E504Q mutant in complex with ATP Deposited 2025-10-10	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Mutation：E504Q	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.16 Å
9X4B Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with ATP and ADP Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.84 Å
9X4C Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with AMPPNP in peptidisc Deposited 2025-10-10	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 3.08 Å
9XKA Cryo-EM structure of Streptococcus thermophilus FoeAB in complex with AMPPNP Deposited 2025-11-05	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 42–623（582 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5M4V7_STRT2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–582； UniProt 42–623

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9x47
Deposition date deposition_date	2025-10-10
Structure title title	Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 1
Keywords keywords	TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	38.11 Å
Radius of gyration Rg (electron density) rg_electron	38.23 Å
Forward intensity I(0) i0	226105000.00
Molecular weight molecular_weight	128410.0 kDa
Excluded volume excluded_volume	163680 Å³
Envelope volume envelope_volume	218250 Å³
Hydration-shell volume shell_volume	48884 Å³
Envelope diameter envelope_diameter	128.9 Å
Shell Rg shell_rg	43.45 Å
Envelope Rg envelope_rg	37.01 Å
Shape Rg shape_rg	38.22 Å
Total Rg total_rg	38.62 Å
Total atoms total_atoms	9041
Residues n_residues	1142
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	127.7 Å
Rg (real space) rg_real	38.22 Å
Rg uncertainty (real space) rg_real_error	0.89 Å
I(0) (real space) i0_real	2.2610e+08
I(0) uncertainty (real space) i0_real_error	3.0660e+06
Rg (reciprocal space) rg_reciprocal	38.16 Å
I(0) (reciprocal space) i0_reciprocal	226100000.0000
Solution quality estimate total_estimate	0.8822
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	43.6 Å
Skewness Skewness skewness	0.387
Kurtosis Kurtosis kurtosis	-0.410
Angular range angular_range	— – 0.2050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	27920000.0000
Real-space data points n_real_points	42
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.879; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.977; Smooth: 0.850

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein
Molecular weight formula_weight	67879.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	9041

MKALLVYFKGFVKDSILGPVFKLIEASFELLVPMVIAGIVDITIPNRDQNHLFMMIFLLFGLAVIGVVVAISAQYFSSRAAVGYAQALTNDLYAKIMRLSKEKRDEIGTSSLVTRLTGDTFQIQTGINQFLRLFLRAPIIVTGAIIMAFRISPRLTLWFIGMVLVLSLIIVLASRIVNPLYAKIRLINESIVTNTRQQLEGMRVIRAFGQSERELDNFTTVNKELKKWQLKTGVISSLISPLTFLVVNMTLIAILWQGNVQIQGGLLSQGMLIALVNYLLQILAELLKLAMMLTNLNQSFISAKRVQAIFNLQDEDIEAPLIIKKPNQPSIALEIDKMTFTYPTASQPSLQEIDFKTFEGESLGIIGGTGSGKSTLVNLIMNLYKPQFGSLTIFKNQLSPNNLKEWRSWVAYVPQKAELFRGTIRSNLSLGLDYEPSDQELWHALDMAQASDFVREKELGLDEPVESFGRNFSGGQRQRLTIARALMRPAPFLILDDSTSALDYLTESRLLAAIRENLKSTSLIIISQRPNSLKAVDQILVLDKGHQVGLGNHEELLATNKIYQDIHYSQHQKVVADEGGSAWSHPQFEKGGGSGGGSGGSAWSHPQLEK

来源 Source

来源生物 organism	Streptococcus thermophilus
NCBI Class编号 ncbi_taxonomy_id	1308
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein
Molecular weight formula_weight	65864.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKARNNKSTLKRLCKDILSQCYLFALATVGTIVQVALTVYFPILLGDAVDAVLKMNAVFLMSRLIWQMLLLILANSAIQWLNPLIYNRLIYSYSESLRERVMMKIHAIPFSYLDRQGTGDMVSRVTTDSDQLNNGLLMFFNQFFVGLLTIFVIIITMARLDWFMMLLVLVMTPLSMLVTRFIARKSYQLYRNQTKWRGKQTQLIEESLTQEALVQILNAQDQMVRNFNEVNGKYANYSQGAIFYSSAVNPATRFFNSLLYALITGVGAYRIMSGGTFTVGQLTTFLNYVTQYTKPFNDISSVLSELQSALACADRLYMILDEDEIPETGNAVLDEAEVQGHFQFDHVQFGYLQNKPLIKDLSIDIPAASTVAIVGPTGAGKSTLINLLMRFYDLDKGQILLDGRDITYYTRESLRKQIGMVLQETWLKVATIHDNIAYGNPKASREEVVAAAKAANADFFIKQLPLGYDTFLKDAGQSLSQGQRQLLTIARIFVNVPKILILDEATSSIDTRTELLIQEAFAKLMKGRTSFIIAHRLSTIENADLILVMNNGDIVEHGTHNQLMRTKGMYYRMQTAQKTQNN

来源 Source

来源生物 organism	Streptococcus thermophilus
NCBI Class编号 ncbi_taxonomy_id	1308
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	47962

fit	/app/data/saxs_computation/x4/9x47/9x47.fit
pddf	/app/data/pr_computation/x4/9x47/9x47.pr.out
profile	/app/data/saxs_computation/x4/9x47/9x47.dat

Cryo-EM structure of nucleotide-free Streptococcus thermophilus FoeAB 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein

State in the Current Structure

Other States of the Same Protein in the Database

Lipid/multidrug/protein-type ABC exporter, ATP binding/membrane-spanning protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)