The structure of sheath and tube proteins of phage Phikz

Method: ELECTRON MICROSCOPY D_max: 301.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9xpf
deposition_date	2025-11-16
title	The structure of sheath and tube proteins of phage Phikz
keywords	sheath, tube, VIRAL PROTEIN; VIRAL PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	85.43 Å
rg_electron	85.40 Å
i0	22526400000.00
molecular_weight	1270900.0 kDa
excluded_volume	1585100 Å³
envelope_volume	2868600 Å³
shell_volume	265840 Å³
envelope_diameter	264.8 Å
shell_rg	95.04 Å
envelope_rg	81.72 Å
shape_rg	85.38 Å
total_rg	85.54 Å
total_atoms	89568
n_residues	11376
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	301.0 Å
rg_real	88.96 Å
rg_real_error	1.68 Å
i0_real	2.2570e+10
i0_real_error	4.6790e+08
rg_reciprocal	86.16 Å
i0_reciprocal	22570000000.0000
total_estimate	0.8961
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	100.3 Å
skewness	0.395
kurtosis	-0.124
angular_range	— – 0.0900 Å⁻¹
current_alpha	1.0550
highest_alpha	21750000000.0000
n_real_points	19
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.843; Stabil: 0.880; Sysdev: 1.000; Positv: 1.000; Valcen: 0.939; Smooth: 0.562

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	PHIKZ029
formula_weight	77712.3 kDa
src_method	nat
entity_count	12

Polymer

type	polypeptide(L)
strand_id	A,B,C,D,E,F,M,N,O,P,Q,R
atom_count	89568

MAYYNAVPRVVFNGIRDRSRRPLIRPDITFAQHCPLLRLFTETGPTETTYVGDSDDGFASIYGQASLDPRSKFFNTQSLLALNLLGRGNGFYVKRLRPEDAANPSRLIVAIEIVEDEIPLTIRRLSGFNYPNSVRDIGNAPVPTTDKVDGLKARIILIEDNTSEVGTQRVLPGTLVSDKDGSQSLVYPLFEAPVSFFGKLGDSNGMRVWSTTTADIEEFDEAAMAKFKTRQFRIQLIEKPEVGTSPVIVKTADQQDYLNITFDKGVYSDMYNADLYVGDVLVDSYSDDGVVSGLSPLYSPFSQFYVYHENIDLVRQMIYDTEMRVNPAAAAHTTAPGEIDFLTFLAVDGDPYQGIQVLGPLDGGITLGKDGNIYASGGTDGTTDLEEYAKLVDIENINFGKLNDRYNNIAEYQFGVLYDTGLPMESKYRAMRVLSARRDLQYFFTTFVETDSRLPDEATELSRVQQIITRLKAFPESTLYGTGVCRAMIVMQSGKLMDGTYRKYVPQLLDVAMSWARYAGAGTGNLVPGMEMDVSPNNRVTFVKDLNVKFFDDRVRAQAWANGATWSQSYDHRSSYYPCLRSVMLDDTSVLLSPITVNICCVLIRLIHKVHAQFSGNATLTPEQLVERCDEYILDLVRDMFGTRVNIIPRTEITPIDANNGTSWTCNVTVEANNPRTTLNFNLETVRIETPPAQQ

Entity 2 polymer

description	PHIKZ030
formula_weight	32686.6 kDa
src_method	nat
entity_count	12

Polymer

type	polypeptide(L)
strand_id	G,H,I,J,K,L,S,T,U,V,W,X

MARYNDPMAPETGYGAGGARNTVNLAQAGTNVFRPDLANLATNTPYVARNLVPFLLDAPRFFKYASNTNWLVACLKAFVETHTRTIDGLQRTLTVDNAEAPWGGSGEVIQTATNVTRARSNPNFGCWELQNRAIQRFLQWWINYGIADENTKVPRIVSDGIVPVEKYDATFYGMTVLFVEPDPTFQDCVNAYLCTNMFPLTTGPWENRKDASQIGQNLDLNVEFSALTDVSEGVQEYARQMFRKLNIRGMNPNNQKLDWGGLSADVLRARNGIQDQIERAVGNRVTYDGVGLS

▶

6. Citations (1)

▶

resolution	3.150 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	3.15 Å
resolution_method	—
num_particles	26028

fit	/app/data/saxs_computation/xp/9xpf/9xpf.fit
pddf	/app/data/pr_computation/xp/9xpf/9xpf.pr.out
profile	/app/data/saxs_computation/xp/9xpf/9xpf.dat

The structure of sheath and tube proteins of phage Phikz

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Refinement

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Entity 2 polymer

Polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)