SAXSdb — 9ylp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BCL11 transcription factor A

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 373–433	Fragment：C2H2 zinc finger domains 2 and 3	DNA Strand II × 1 DNA Strand I × 1 ZN ZINC ION × 4 MG MAGNESIUM ION × 1 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；278 K；28 % w/v PEG 4000, 0.1 M Sodium citrate (pH 6.5), 0.1 M Magnesium acetate tetrahydrate, 0.1 M Ammonium sulfate	Resolution 2.04 Å R-free 0.245

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YLP	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5VTB Crystal structure of RBBP4 bound to BCL11a peptide Deposited 2017-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–16（15 aa） Fragment：UNP residues 2-16	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% PEG2000 MME, 0.1 M potassium thiocyanate	Resolution 2.40 Å R-free 0.244
6KI6 Crystal structure of BCL11A in complex with gamma-globin -115 HPFH region Deposited 2019-07-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 731–835（105 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M calcium acetate hydrate, 0.1 M sodium cacodylate trihydrate (pH6.5), 18% w/v polyethylene glycol 8,000	Resolution 2.50 Å R-free 0.251
6KI6 Crystal structure of BCL11A in complex with gamma-globin -115 HPFH region Deposited 2019-07-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 731–835（105 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M calcium acetate hydrate, 0.1 M sodium cacodylate trihydrate (pH6.5), 18% w/v polyethylene glycol 8,000	Resolution 2.50 Å R-free 0.251
6U9Q Crystal Structure Analysis of DNA-BCL11A Znf domain complex Deposited 2019-09-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa）	Not recorded	ZN ZINC ION × 3 PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；NaMalate~8.0	Resolution 1.83 Å R-free 0.195
8DTN The complex of nanobody 6101 with BCL11A ZF6 Deposited 2022-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 797–826（30 aa） Chain D 797–826（30 aa） Chain F 797–826（30 aa） Chain H 797–826（30 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 4 ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M Bis-Tris propane, pH 6.0-7.0, 0.2 M NaKPO4 and 18%-20% PEG 3350	Resolution 2.20 Å R-free 0.232
8DTN The complex of nanobody 6101 with BCL11A ZF6 Deposited 2022-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 797–826（30 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M Bis-Tris propane, pH 6.0-7.0, 0.2 M NaKPO4 and 18%-20% PEG 3350	Resolution 2.20 Å R-free 0.232
8DTN The complex of nanobody 6101 with BCL11A ZF6 Deposited 2022-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 797–826（30 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M Bis-Tris propane, pH 6.0-7.0, 0.2 M NaKPO4 and 18%-20% PEG 3350	Resolution 2.20 Å R-free 0.232
8DTN The complex of nanobody 6101 with BCL11A ZF6 Deposited 2022-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 797–826（30 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 3 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M Bis-Tris propane, pH 6.0-7.0, 0.2 M NaKPO4 and 18%-20% PEG 3350	Resolution 2.20 Å R-free 0.232
8DTN The complex of nanobody 6101 with BCL11A ZF6 Deposited 2022-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 797–826（30 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M Bis-Tris propane, pH 6.0-7.0, 0.2 M NaKPO4 and 18%-20% PEG 3350	Resolution 2.20 Å R-free 0.232
8DTU The complex of nanobody 5344N74D with BCL11A ZF6. Deposited 2022-07-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 799–826（28 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；281.15 K；0.1 M HEPES, pH 7.5-8.2, 2.2M Li2SO4.	Resolution 2.45 Å R-free 0.288
8THO Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) Deposited 2023-07-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 737–835（99 aa） Fragment：residues 737-835	Not recorded	ZN ZINC ION × 3	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 163；Pressure 1 NMR sample composition 137 mM sodium chloride, 2.7 mM potassium chloride, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 1 mM dithiothreitol, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8TLO Crystal Structure Analysis of BCL11A in complex with DNA Deposited 2023-07-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；30% PEG6K and 0.1M Na Citrate pH 5.0	Resolution 2.76 Å R-free 0.269
9B4P Tetramer Formation of the BCL11A ZF0 Domain Deposited 2024-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 45–71（27 aa） Fragment：ZF0 domain Chain C 45–71（27 aa） Fragment：ZF0 domain	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.3；291.15 K；0.2M potassium nitrate, 0.1M Tris-HCl pH 7.3, 20% PEG3350	Resolution 2.56 Å R-free 0.294
9B4P Tetramer Formation of the BCL11A ZF0 Domain Deposited 2024-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 45–71（27 aa） Fragment：ZF0 domain Chain D 45–71（27 aa） Fragment：ZF0 domain Chain E 45–71（27 aa） Fragment：ZF0 domain Chain F 45–71（27 aa） Fragment：ZF0 domain	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.3；291.15 K；0.2M potassium nitrate, 0.1M Tris-HCl pH 7.3, 20% PEG3350	Resolution 2.56 Å R-free 0.294
9B4P Tetramer Formation of the BCL11A ZF0 Domain Deposited 2024-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain G 45–71（27 aa） Fragment：ZF0 domain Chain H 45–71（27 aa） Fragment：ZF0 domain Chain I 45–71（27 aa） Fragment：ZF0 domain Chain J 45–71（27 aa） Fragment：ZF0 domain	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.3；291.15 K；0.2M potassium nitrate, 0.1M Tris-HCl pH 7.3, 20% PEG3350	Resolution 2.56 Å R-free 0.294
9BV0 NMR structure of the Z0 CCHC zinc-finger of transcription repressor Bcl11A Deposited 2024-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–72（27 aa） Fragment：B0 atypical C2HC zinc-finger domain, residues 46-72	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.3；298 K；Ionic strength (raw mmCIF value) 0.6；Pressure 1 NMR measurement conditions pH 5.8；298 K；Ionic strength (raw mmCIF value) 0.6；Pressure 1 NMR sample composition 40 uM Bcl11A-Z0, 600 uM Zn2+, 90% H2O/10% D20 \| 90% H2O/10% D20 NMR sample composition 40 uM Bcl11A-Z0, 600 uM Zn2+, 100% D20 \| 100% D2O	Resolution not provided
9E6R BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGACCA Deposited 2024-10-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 3 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；292 K；24 % v/v Ethanol, 0.1 M HEPES 7.8, 40 mM Magnesium chloride hexahydrate	Resolution 2.09 Å R-free 0.238
9E6R BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGACCA Deposited 2024-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；292 K；24 % v/v Ethanol, 0.1 M HEPES 7.8, 40 mM Magnesium chloride hexahydrate	Resolution 2.09 Å R-free 0.238
9E6R BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGACCA Deposited 2024-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain Y 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；292 K；24 % v/v Ethanol, 0.1 M HEPES 7.8, 40 mM Magnesium chloride hexahydrate	Resolution 2.09 Å R-free 0.238
9E6S BCL11A ZF4-6 with K784T Mutation in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGACCA Deposited 2024-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6 Chain D 730–835（106 aa） Fragment：Zinc finger domains 4-6	Mutation：K784T Mutation：K784T	EDO 1,2-ETHANEDIOL × 1 ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；292 K；18 % w/v PEG 3350, 17 % v/v PEG 400, 4.8 % v/v 2-Propanol, 0.1 M CAPSO 9.0	Resolution 2.20 Å R-free 0.275
9E6T BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGCCCA Deposited 2024-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6 Chain B 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 6 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；292 K；15 % w/v PEG 1000, 30 % v/v PEG 300, 0.1 M Bis-Tris Propane 7.0	Resolution 2.78 Å R-free 0.281
9YLL BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (20-mer) Deposited 2025-10-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.9；292 K；20% w/v Polyethylene glycol 3,350 0.2M sodium chloride	Resolution 2.38 Å R-free 0.247
9YLM BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (12-mer) Deposited 2025-10-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；28 % w/v PEG 4000, 0.1 M Sodium citrate (pH 5.2), 0.2 M Ammonium acetate	Resolution 1.91 Å R-free 0.244
9YLN BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGGCCA (12-mer) Deposited 2025-10-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 730–835（106 aa） Fragment：Zinc finger domains 4-6	Not recorded	ZN ZINC ION × 3 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；28 % w/v PEG 4000, 0.1 M Sodium citrate (pH 5.2), 0.2 M Ammonium acetate	Resolution 2.15 Å R-free 0.247
9YLO BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (P21212 crystal form) Deposited 2025-10-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 373–433（61 aa） Fragment：C2H2 zinc finger domains 2 and 3	Not recorded	EDO 1,2-ETHANEDIOL × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；292 K；10% w/v PEG 20 000, 20% v/v PEG MME 500, 60mM sodium fluoride, 60mM sodium bromide, 60mM sodium iodide, 0.1M Bicine- TRIS-base (pH 8.5)	Resolution 1.97 Å R-free 0.241

16 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BC11A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–63； UniProt 373–433

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ylp
Deposition date deposition_date	2025-10-08
Structure title title	BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (C2221 Crystal Form)
Keywords keywords	TRANSCRIPTION FACTOR, DNA BINDING, TRANSCRIPTION, TRANSCRIPTION-DNA COMPLEX, GLOBIN LOCUS, DNA BINDING PROTEIN; TRANSCRIPTION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	15.32 Å
Radius of gyration Rg (electron density) rg_electron	14.75 Å
Forward intensity I(0) i0	7187990.00
Molecular weight molecular_weight	14272.0 kDa
Excluded volume excluded_volume	15508 Å³
Envelope volume envelope_volume	19790 Å³
Hydration-shell volume shell_volume	11805 Å³
Envelope diameter envelope_diameter	56.7 Å
Shell Rg shell_rg	19.90 Å
Envelope Rg envelope_rg	15.07 Å
Shape Rg shape_rg	14.67 Å
Total Rg total_rg	15.68 Å
Total atoms total_atoms	954
Residues n_residues	80
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	37.5 Å
Rg (real space) rg_real	14.69 Å
Rg uncertainty (real space) rg_real_error	0.03 Å
I(0) (real space) i0_real	6.8840e+06
I(0) uncertainty (real space) i0_real_error	4.6740e+04
Rg (reciprocal space) rg_reciprocal	15.25 Å
I(0) (reciprocal space) i0_reciprocal	7188000.0000
Solution quality estimate total_estimate	0.6881
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	18.5 Å
Skewness Skewness skewness	0.050
Kurtosis Kurtosis kurtosis	-0.601
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	2.4340
Highest regularization parameter α highest_alpha	509400.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.001; Oscil: 1.000; Stabil: 0.982; Sysdev: 0.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	BCL11 transcription factor A
Molecular weight formula_weight	7318.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	984

HMPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLKRHMKTHMHKSSP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	DNA Strand II
Molecular weight formula_weight	3686.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

AGATGGACATTC

Entity 3 Entity 3 polymer

Description description	DNA Strand I
Molecular weight formula_weight	3637.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

GAATGTCCATCT

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	30

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.899 Å
Unit-cell length b length_b	69.554 Å
Unit-cell length c length_c	129.174 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	2.040 Å
Low-resolution limit resolution_low	34.780 Å
R factor r_factor	0.2113
R_work r_work	0.2095
R_free r_free	0.2447

fit	/app/data/saxs_computation/yl/9ylp/9ylp.fit
pddf	/app/data/pr_computation/yl/9ylp/9ylp.pr.out
profile	/app/data/saxs_computation/yl/9ylp/9ylp.dat

BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (C2221 Crystal Form)

1. Protein Identity and Related Structures Protein Identity & Related Structures

BCL11 transcription factor A

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)