SAXSdb — 9zm7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Circumsporozoite protein

Plasmodium falciparum 3D7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
2	Protein heterocomplex	Heteromer	Protein 3	Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Heavy Chain of Fab 7160 × 1 Light Chain of Fab 7160 × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSP_PLAF7
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–16； UniProt 101–116 Author chain F； PDBConstruct 1–16； UniProt 101–116 Author chain K； PDBConstruct 1–16； UniProt 101–116 Author chain L； PDBConstruct 1–16； UniProt 101–116 Author chain O； PDBConstruct 1–16； UniProt 101–116 Author chain R； PDBConstruct 1–16； UniProt 101–116 Author chain U； PDBConstruct 1–16； UniProt 101–116 Author chain X； PDBConstruct 1–16； UniProt 101–116

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9zm7
Deposition date deposition_date	2025-12-09
Structure title title	Crystal structure of Fab 7160 in complex with junctional region from circumsporozoite protein
Keywords keywords	Antibody for Malaria, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9zm7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9zm7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9zm7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.06 Å
Rg (electron density)	39.35 Å
Total Rg	39.43 Å
Atom count	4999
Residues	661
Excluded volume	88804 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9zm7__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9zm7__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`9zm7__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`9zm7__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`9zm7__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`9zm7__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`9zm7__assembly_7__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`9zm7__assembly_8__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Heavy Chain of Fab 7160
Molecular weight formula_weight	24421.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,A,D,G,M,P,S,V
Atom count atom_count	27733

EVQLVESGGGLVQPGRSLRVSCTTSGFTFGDYAMSWFRQAPGKGLEWVGFIRSKGYGGTPEYAASVKGRFTISRDDSKRTAYLQMNSLKTEDTAVYYCTRVGIEVSTAVYWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHLC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	Light Chain of Fab 7160
Molecular weight formula_weight	24246.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,B,E,H,N,Q,T,W

DIVMTQTPLSLSVTPGQPASISCKSSQSLLDNDGKTYLYWYLQKPGQSPQLVIYEVSNRFSGVPDRFSGSGSGTDFTLKIRRVEAEDVGVYYCMQRIDLPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	Circumsporozoite protein
Molecular weight formula_weight	1659.7 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,C,F,L,O,R,U,X

NPDPNANPNVDPNANP

Source Source

Source organism organism	Plasmodium falciparum 3D7
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	synthetic construct

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	336

▶

Unit-cell length a length_a	88.190 Å
Unit-cell length b length_b	105.127 Å
Unit-cell length c length_c	405.183 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 2 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	29.880 Å
R factor r_factor	0.2291
R_work r_work	0.2285
R_free r_free	0.2748

Crystal structure of Fab 7160 in complex with junctional region from circumsporozoite protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Circumsporozoite protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zm7__assembly_1__model_1

9zm7__assembly_1__model_1 | I(q)

9zm7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of Fab 7160 in complex with junctional region from circumsporozoite protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Circumsporozoite protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zm7__assembly_1__model_1

9zm7__assembly_1__model_1 | I(q)

9zm7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)