SAXSdb — 9zs2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A)

Serratia

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	CRISPR system Cms endoribonuclease Csm3 × 4 （A0A2I5TNQ0） CRISPR system Cms protein Csm4 × 1 （A0A2I5TQV2） CRISPR system Cms protein Csm5 × 1 （A0A2I5TBB3） RNA (30-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I5TNR6_SERS3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–816； UniProt 1–816

CRISPR system Cms endoribonuclease Csm3

Serratia

UniProt A0A2I5TNQ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A) × 1 （A0A2I5TNR6） CRISPR system Cms protein Csm4 × 1 （A0A2I5TQV2） CRISPR system Cms protein Csm5 × 1 （A0A2I5TBB3） RNA (30-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I5TNQ0_SERS3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–248； UniProt 1–248 Author chain F； PDBConstruct 1–248； UniProt 1–248 Author chain G； PDBConstruct 1–248； UniProt 1–248 Author chain H； PDBConstruct 1–248； UniProt 1–248

CRISPR system Cms protein Csm4

Serratia

UniProt A0A2I5TQV2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A) × 1 （A0A2I5TNR6） CRISPR system Cms endoribonuclease Csm3 × 4 （A0A2I5TNQ0） CRISPR system Cms protein Csm5 × 1 （A0A2I5TBB3） RNA (30-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I5TQV2_SERS3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–326； UniProt 1–326

CRISPR system Cms protein Csm5

Serratia

UniProt A0A2I5TBB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A) × 1 （A0A2I5TNR6） CRISPR system Cms endoribonuclease Csm3 × 4 （A0A2I5TNQ0） CRISPR system Cms protein Csm4 × 1 （A0A2I5TQV2） RNA (30-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I5TBB3_SERS3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–559； UniProt 1–559

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9zs2
Deposition date deposition_date	2025-12-22
Structure title title	S. marcescens Cas10-Csm unbound to target RNA
Keywords keywords	CRISPR, crRNA, Cas10, type III, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9zs2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9zs2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9zs2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.33 Å
Rg (electron density)	59.48 Å
Total Rg	59.37 Å
Atom count	18542
Residues	2338
Excluded volume	326300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9zs2__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A)
Molecular weight formula_weight	90390.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	18542

MNWLAASCHVAAFALLHNLKPLAQRAGIQDFPSPALANKLFAPLPESLSARADLHENTLTLLLDFAARLARGLPETPVSRGETGLIPLTHLLADDNHSAPAERCYSPLAPLGVDSLMPVTAALPTGERQAAYRQVYQALIEGLEAIPAAHRLQPSLWLDHLDSLWMTTCHALPDGDGASGISLYDQGKTTAALAVALWQHHARQATPEKEISLTPGDDARLLLIQADVFGIQELIFAQGNQTQKMAAKLLRGRSFQVSLLAETAALRVLETFDLPPVCQLINAAGKSLIVAPNLPDAAERLAGLRQRLDEWFLTHTYAQTGIGLCSTVAGSAEFLGEQAYGRLQNRLAQAMEQQKYQRFSLCAGDAPPPVFEGYLDQIAQGAGGEPCPMNGLHPVETTLNGLGCSRLAADQITLGHWINHGHWISHGERYARLLILRDSTATFSDDRCLHLTLFGYQVVAVSLKEDSGEFGELACNGSLRRCWDVSLPPEGTSLFQGYARRFINGWMPLAQGEYQPECYPGIEEALANGDIKTFDHLSCEDLYQDADQSLRGTCALGVLKGDIDNLGHLFRSGLPQPGFAKTIGLSRQIHLFFTLWLPHLCRKDPRFANTYTVFAGGDDFFLIGPWRSQQTLALTMAQDFARYSGHNPALHFSLGLVQAKPGYPVRALAAQAEAALKQAKQHPGKNAICLYNEVMGWPEYDALLACSEELARWREHDGYPLSSGLLYRLLALSEQSAEESEKPQAALWRSRLAYFLRRNLVDNVKVPTKENPAAFRHQLHLELFEKLEQHLKRHRQRYRVALQRHLYHYRTVPRGE

Source Source

Source organism organism	Serratia
NCBI taxonomy ID ncbi_taxonomy_id	613
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	CRISPR system Cms endoribonuclease Csm3
Molecular weight formula_weight	27185.9 kDa
Mutation mutation	D43A
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

MQLNNIQTLRATLVCETGLHIGGGDTALQIGGIASAVVRHPLTQQPYIPGSSLKGKLRSLLEWRAGVVGDTEGKVLSHQVYQQLIDDKKQAQALQALKILQLFGVSGGDKLSAEQAQQIGPTRLSFWDCEFDEHWLAQQGGRVQTEEKAENCIDRISGVALHPRFIERVPAGSRFDFRLTVRQLDGDSPDLLDTLLAGLKMLELDGLGGSISRGYGKVRFEALTLDGKDLQPRFEQLQPFKHTTQGAG

Source Source

Source organism organism	Serratia
NCBI taxonomy ID ncbi_taxonomy_id	613
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CRISPR system Cms protein Csm4
Molecular weight formula_weight	35770.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MPSPVAPAAAWQWLRLRLLPDSAFATALRGDTLFGQLCWYLRESLGEAGLNALLAGYHDQRPFAVISDPMLADHLPRPHLPEHRLGFAAADARARKQRKQQCWLPLAFAHQPLAEWGAHLTAAPEHHQHRSDVQMHNSINRQTLTTGGDDAFAPFGSEQHWFDVDTAWDLYLLHDKRLSAAQLTDALRAIGLLGYGKDASIGKGRFHLTPQPMPELPTPDGNPLRLTLAPCAPQQGHWHSADSFFSPLVRVGRHGAALVVQGHPFKNPLLLADSAAVLAPVTPDNRPFVGQGLGGNGRLSTALPQTVHQGYAPVIPVRFHHKAQPQ

Source Source

Source organism organism	Serratia
NCBI taxonomy ID ncbi_taxonomy_id	613
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	CRISPR system Cms protein Csm5
Molecular weight formula_weight	63148.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTRDQTPRRHTACDSDNMQYFTLTCLSPVHVATGDSLNPGEYLIDENALYELGQGGLSPALTATQRSELLTILESNDPALPLTVQRFLAREAGKLKYAARRMCPLLPGISRYYQSRLGQVMQNDTKNKKQMINQLELMRHVGAALGAPYIPGSTLKGAIRTALVSALNQGQPLQAERRETDKLSSKVAQDAERQLLGFDTRRDSPRYRIEHDPFHWLQVGDAVSPAEHPPMLDYWLVRRQPFKRTEKQDNKADNMELSPVECLKPRQSPLHCQITVKTPPTALAIKNPRLKQWLGKVSQLAQQVNRITLPQCHHELAWLAEKHIGTDDVYAPGQNWVAQMQQLLRQLDDPLQRGEALLLRVGKYGGAISKTVAGWRHIARLGRQGTRTTYHPDVTTCTLALPQADALTQALPFGWVLLHQPDQPEVTEFVASHHDWCQQQQQRLDAHQQQQHTHRQQRQQLAQAREEEAQRLADKARQSKARQSIMSLAEQLASEQTFQHKNPNGPLRGQLATCVGCVATEGSAEEKAELCTLFDDILNYWGIKPGKDKKLTALRNKLL

Source Source

Source organism organism	Serratia
NCBI taxonomy ID ncbi_taxonomy_id	613
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	RNA (30-MER)
Molecular weight formula_weight	13361.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	K

AUUAAGACCAUUUACAGAACCUGUUCCACUUAAUGAAGUUGC

Source Source

Source organism organism	Serratia
NCBI taxonomy ID ncbi_taxonomy_id	613
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	42471

S. marcescens Cas10-Csm unbound to target RNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A)

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR system Cms endoribonuclease Csm3

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR system Cms protein Csm4

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR system Cms protein Csm5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zs2__assembly_1__model_1

9zs2__assembly_1__model_1 | I(q)

9zs2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

S. marcescens Cas10-Csm unbound to target RNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR system single-strand-specific deoxyribonuclease Cas10/Csm1 (subtype III-A)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR system Cms endoribonuclease Csm3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR system Cms protein Csm4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR system Cms protein Csm5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zs2__assembly_1__model_1

9zs2__assembly_1__model_1 | I(q)

9zs2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)