The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDB28",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Structure and activation of C1, the complex initiating the classical pathway of the complement cascade.",
"publication": {
"title": "Structure and activation of C1, the complex initiating the classical pathway of the complement cascade.",
"author_list": "Mortensen SA, Sander B, Jensen RK, Pedersen JS, Golas MM, Jensenius JC, Hansen AG, Thiel S, Andersen GR",
"journal": "Proc Natl Acad Sci U S A",
"doi": "10.1073/pnas.1616998114",
"pmid": "28104818",
"published_date": "2017 Jan 31"
},
"status": "released",
"submitted_date": "2016-12-02",
"released_date": "2017-01-09"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB28.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB28_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB28_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB28_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB28.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Complement C1q subcomponent subunit C",
"short_name": "C1qc",
"sequence": "EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKV\r\nGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEE\r\nPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVS\r\nGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA",
"organism": "Homo sapiens",
"uniprot_code": "P02747",
"uniprot_range_first": 23,
"uniprot_range_last": 245,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP\nGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS\nVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV\nLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF\nLLFPD",
"mw": 23.687,
"total_mw": 142.122,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Complement C1q subcomponent subunit B",
"short_name": "C1qb",
"sequence": "QLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPG\r\nKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVIT\r\nNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQV\r\nTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA",
"organism": "Homo sapiens",
"uniprot_code": "P02746",
"uniprot_range_first": 28,
"uniprot_range_last": 253,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG\nEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ\nKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL\nCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS\nIFSGFLLFPDMEA",
"mw": 23.742,
"total_mw": 142.452,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Complement C1q subcomponent subunit A",
"short_name": "C1qa",
"sequence": "EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKV\r\nGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEE\r\nPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVS\r\nGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA",
"organism": "Homo sapiens",
"uniprot_code": "P02745",
"uniprot_range_first": 23,
"uniprot_range_last": 245,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR\nTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI\nRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR\nGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL\nIFPSA",
"mw": 23.687,
"total_mw": 142.122,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM TrisHCl, 145 mM NaCl, 3 mM CaCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Complement factor 1q (C1q)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Aarhus, Denmark",
"full_name": "Aarhus University",
"webpage": "http://www.au.dk"
}
],
"contributor_name": "Rasmus",
"contributor_surname": "Jensen",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-12-08",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 2.0,
"number_of_frames": 10,
"wavelength": 0.0992,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 3.66,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.036,
"s_max": 4.975,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Complement factor 1q (C1q) in 50 mM TrisHCl, 145 mM NaCl, 3 mM CaCl2, pH 7.4, were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a wavelength of λ = 0.0992 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). Solute concentrations ranging between 3.7 and 3.7 mg/ml were measured at 4°C. 10 successive 2 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 407.0,
"experimental_mw_error": null,
"guinier_i0_mw": 407.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 534.52,
"guinier_i0_error": 0.97,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 12.61,
"guinier_rg_error": 0.17,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 15,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDB28_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
