Light state solution structure of untagged Aureochrome1a- A´α-LOV-Jα

{
  "code": "SASDBE2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structure of a Native-like Aureochrome 1a LOV Domain Dimer from Phaeodactylum tricornutum.",
    "publication": {
      "title": "Structure of a Native-like Aureochrome 1a LOV Domain Dimer from Phaeodactylum tricornutum.",
      "author_list": "Banerjee A, Herman E, Kottke T, Essen LO",
      "journal": "Structure",
      "doi": "10.1016/j.str.2015.10.022",
      "pmid": "26688213",
      "published_date": "2016 Jan 5"
    },
    "status": "released",
    "submitted_date": "2015-06-18",
    "released_date": "2016-01-05"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBE2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBE2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBE2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBE2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Aureochrome1a- A´α-LOV-Jα (Light State)",
          "short_name": "PtAUREO1a-LOV",
          "sequence": "GSHMDFSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEEAAANDDED",
          "organism": "Phaeodactylum tricornutum",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": null,
          "mw": 16.1,
          "total_mw": 32.2,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "10 mM Tris-HCl, 300 mM NaCl",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "300 mM NaCl",
        "concentration": 10.0,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Light state solution structure of untagged Aureochrome1a- A´α-LOV-Jα",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Marburg, Germany",
            "full_name": "Philipps-Universität Marburg",
            "webpage": ""
          }
        ],
        "contributor_name": "Ankan",
        "contributor_surname": "Banerjee",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2015-09-09",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 10.0,
    "number_of_frames": 20,
    "wavelength": 0.93,
    "sample_detector_distance": 2.43,
    "concentration_min": 2.0,
    "concentration_max": 8.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.036,
    "s_max": 4.912,
    "total_exposure_time": 200.0,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBE2_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDBE2_fit1_model1.pdb",
          "model_mw": 39.378,
          "bead_radius": 2.75,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 72
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBE2_fit1_fit_img.png",
      "software": null,
      "chi_square_value": 0.787,
      "p_value": 0.0,
      "fit_residual_plot": "SASDBE2_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBE2_fit1.fir",
      "fit_log": null,
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "X-ray synchrotron radiation scattering data were collected from solutions of Aureochrome1a-A´α-LOV-Jα in 10 mM Tris 300 mM NaCl (thrombin-cleaved N-terminal affinity tag). SAXS data were measured on the BM29 beam line on the storage ring ESRF (Grenoble, France) using a 2D Photon counting Pilatus 1M-W pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle. s-range 0.036-4.9 nm-1). Different solute concentrations in the range 2.00-8.00 mg/mL were measured. 10 successive 20 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The low angle data collected were merged with the highest concentration high angle data to yield the final composite scattering curve. The analysis was performed using the ATSAS package. The displayed model is an averaged and volume corrected dummy atom representation (DAMFILT). For further sequence information refer to the Joint Genome Institute (JGI) entry JGI-49116. ",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 48.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": 48.1,
  "guinier_i0_mw_error": null,
  "porod_mw": 44.2,
  "porod_mw_error": null,
  "pddf_i0": 48.35,
  "pddf_i0_error": null,
  "guinier_i0": 48.1,
  "guinier_i0_error": null,
  "pddf_rg": 2.65,
  "pddf_rg_error": null,
  "guinier_rg": 2.6,
  "guinier_rg_error": null,
  "pddf_dmax": 9.8,
  "pddf_dmax_error": null,
  "porod_volume": 66.4,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": null,
  "guinier_point_last": null,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBE2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-07-03T14:55:51.265847+02:00",
  "bragg_peak": []
}

{
  "code": "SASDBE2",
  "status": "success",
  "started_at": "2026-08-11T16:39:22.782858+00:00",
  "finished_at": "2026-08-11T16:39:31.888855+00:00",
  "source_last_modified": "2020-07-03T14:55:51.265847+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBE2/",
      "path": "/data/saxsdb/sasbdb/entries/e2/sasdbe2/source/summary.json",
      "size": 7417,
      "sha256": "b964782c07f5e83b5ca43c0327d114d8e1454acca281c615cd4ad09a73387e89"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBE2.dat",
      "path": "/data/saxsdb/sasbdb/entries/e2/sasdbe2/source/SASDBE2.dat",
      "size": 48418,
      "sha256": "82be51eb966442b70bafb3faa5e713862efca4a8e84c6038f0161b3ac72aa796",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBE2.out",
      "path": "/data/saxsdb/sasbdb/entries/e2/sasdbe2/source/SASDBE2.out",
      "size": 56710,
      "sha256": "2e16d6a5b696005d72928279d27f9bd3feb652b248c34e1ce0d19f2ce4bae379",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBE2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/e2/sasdbe2/source/SASDBE2.sascif",
      "size": 203533,
      "sha256": "5ca74df8e9b92a7939b0e53bdcdb898462081844dff90564692b97e42b46a2df",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBE2.zip",
      "path": "/data/saxsdb/sasbdb/entries/e2/sasdbe2/source/SASDBE2.zip",
      "size": 48821,
      "sha256": "3568d9fb1b1bdd7d257d4b601ac9721c77d82b75e0448db1a74fa7f75ae5b1f5",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}