The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.dat",
"role": "curve",
"sha256": "2899f03cb4036b327a10947c81304d9be9351814b9658ad3d79b6d3ef5c0e3c0",
"size": 48273,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBH2.dat"
} full_entry_zip：source record and ZIP contents (4 items) {
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.zip",
"role": "full_entry_zip",
"sha256": "30f9f4d3bd3e673165f3a5dcc1369a0d33423e2ae6d313790fc31b5706f08b1c",
"size": 55282,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBH2.zip",
"zip_member_count": 4,
"zip_members": [
{
"crc32": "526d2571",
"name": "SASDBH2/experimental_data/SASDBH2.dat",
"size": 48273
},
{
"crc32": "44047f58",
"name": "SASDBH2/pddf/SASDBH2.out",
"size": 74342
},
{
"crc32": "bce2991f",
"name": "SASDBH2/SASDBH2_fit1.fir",
"size": 45471
},
{
"crc32": "8f9ff5c8",
"name": "SASDBH2/SASDBH2_fit1_model1.pdb",
"size": 81706
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.out",
"role": "pddf",
"sha256": "dd43dec8f7480b920e651b040b14301ee432cd102655b152e95437693cffd784",
"size": 74342,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBH2.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.sascif",
"role": "sascif",
"sha256": "797363e11c968f5ed577d4080d1efdc2edc862f120718e324623c5501fcf9440",
"size": 252739,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBH2.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/summary.json",
"sha256": "b84c5c81b33e7d0bca37bf072e5f960bcd4775fe8b53005ad03776663f48c968",
"size": 7447,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBH2/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：156 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDBH2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Wing phosphorylation is a major functional determinant of the Lrs14-type biofilm and motility regulator AbfR1 in Sulfolobus acidocaldarius.",
"publication": {
"title": "Wing phosphorylation is a major functional determinant of the Lrs14-type biofilm and motility regulator AbfR1 in Sulfolobus acidocaldarius.",
"author_list": "Li L, Banerjee A, Bischof LF, Maklad HR, Hoffmann L, Henche AL, Veliz F, Bildl W, Schulte U, Orell A, Essen LO, Peeters E, Albers SV",
"journal": "Mol Microbiol",
"doi": "10.1111/mmi.13735",
"pmid": "28628237",
"published_date": "2017 Sep"
},
"status": "released",
"submitted_date": "2015-10-01",
"released_date": "2017-05-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBH2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBH2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBH2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBH2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBH2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBH2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBH2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Archaeal biofilm regulator 1 (AbfR1) mutant Y84E S87D phosphomimic mutant ",
"short_name": "ABfR1 mutant Y84E S8",
"sequence": "MSIEITEKYVILKRFLSVAYGLSESEIDTFLRILESKEGKDIDAISAELKISKSRTSIIL KKLSDAGLVDKEKGDNMKGGRPKEVYDVNKEELKNRLIAKSEELCKELNQVIKSFI\r\n",
"organism": "Sulfolobus acidocaldarius",
"uniprot_code": "Q4JBH1",
"uniprot_range_first": 1,
"uniprot_range_last": 116,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSIEITEKYVILKRFLSVAYGLSESEIDTFLRILESKEGKDIDAISAELKISKSRTSIIL\nKKLSDAGLVDKEKGDNMKGGRPKYVYSVNKEELKNRLIAKSEELCKELNQVIKSFI",
"mw": 13.16,
"total_mw": 26.32,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES 200 mM NaCl",
"concentration_unit": "mM",
"comment": null,
"additive": "200 mM NaCl",
"concentration": 20.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Mutant archaeal biofilm regulator 1 (ABfR1) phosphomimic Y84E S87D",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marburg, Germany",
"full_name": "Philipps-Universität Marburg",
"webpage": ""
}
],
"contributor_name": "Ankan",
"contributor_surname": "Banerjee",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-08-27",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 20.0,
"number_of_frames": 10,
"wavelength": 0.93,
"sample_detector_distance": 2.43,
"concentration_min": null,
"concentration_max": 3.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.033,
"s_max": 4.934,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBH2_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBH2_fit1_model1.pdb",
"model_mw": 34.302,
"bead_radius": 2.25,
"log": null,
"symmetry": "",
"comment": "",
"user": 72
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBH2_fit1_fit_img.png",
"software": null,
"chi_square_value": 0.957,
"p_value": 0.0,
"fit_residual_plot": "SASDBH2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBH2_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from solutions of N terminal affinity tag cleaved (by thrombin) AbfR1 Y84E S87D phosphomimic mutant in 20mMHEPES pH7.5, 200mM NaCl were collected on the BM29 beam line on the storage ring ESRF (Grenoble, France) using a 2D Photon counting Pilatus 1M pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). A 3.8 mg/mL concentration was measured. 10 successive 20 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The analysis was performed using the ATSAS package. The displayed model is an averaged and volume corrected dummy atom representation (DAMFILT) after imposing P2 symmetry.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 32.3,
"experimental_mw_error": null,
"guinier_i0_mw": 32.25,
"guinier_i0_mw_error": null,
"porod_mw": 33.3,
"porod_mw_error": null,
"pddf_i0": 32.3,
"pddf_i0_error": null,
"guinier_i0": 32.2,
"guinier_i0_error": null,
"pddf_rg": 2.69,
"pddf_rg_error": null,
"guinier_rg": 2.64,
"guinier_rg_error": null,
"pddf_dmax": 9.5,
"pddf_dmax_error": null,
"porod_volume": 50.93,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 96,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBH2_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDBH2",
"status": "success",
"started_at": "2026-08-11T13:38:39.876601+00:00",
"finished_at": "2026-08-11T13:38:48.378087+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBH2/",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/summary.json",
"size": 7447,
"sha256": "b84c5c81b33e7d0bca37bf072e5f960bcd4775fe8b53005ad03776663f48c968"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBH2.dat",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.dat",
"size": 48273,
"sha256": "2899f03cb4036b327a10947c81304d9be9351814b9658ad3d79b6d3ef5c0e3c0",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBH2.out",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.out",
"size": 74342,
"sha256": "dd43dec8f7480b920e651b040b14301ee432cd102655b152e95437693cffd784",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBH2.sascif",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.sascif",
"size": 252739,
"sha256": "797363e11c968f5ed577d4080d1efdc2edc862f120718e324623c5501fcf9440",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBH2.zip",
"path": "/data/saxsdb/sasbdb/entries/h2/sasdbh2/source/SASDBH2.zip",
"size": 55282,
"sha256": "30f9f4d3bd3e673165f3a5dcc1369a0d33423e2ae6d313790fc31b5706f08b1c",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
} 
