The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBS7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core.",
"publication": {
"title": "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core.",
"author_list": "Chen Y, Tokuda JM, Topping T, Meisburger SP, Pabit SA, Gloss LM, Pollack L",
"journal": "Proc Natl Acad Sci U S A",
"doi": "10.1073/pnas.1611118114",
"pmid": "28028239",
"published_date": "2017 Jan 10"
},
"status": "released",
"submitted_date": "2016-10-27",
"released_date": "2017-02-15"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBS7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBS7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBS7_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBS7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBS7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "Advanced Photon Source (APS), Argonne National Laboratory",
"city": "Lemont, IL",
"country": "USA",
"beamline_name": "BioCAT 18ID",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Nucleasome Core Particle with Widom 601 DNA - HISTONE H2A-H2B Heterodimer",
"short_name": null,
"sequence": "GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK\r\n\r\nKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK",
"organism": "Xenopus laevis",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 23.754,
"total_mw": 47.508,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Nucleasome Core Particle with Widom 601 DNA - HISTONE H3-H4 Heterodimer",
"short_name": null,
"sequence": "LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA\r\n\r\nKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG",
"organism": "Xenopus laevis",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 23.168,
"total_mw": 46.336,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Nucleasome Core Particle with Widom 601 DNA - dsDNA",
"short_name": null,
"sequence": "ATCGGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCGAT\r\n \r\n\r\nATCGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCCGAT",
"organism": "Xenopus laevis",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "DNA",
"uniprot_sequence": null,
"mw": 92.093,
"total_mw": 92.093,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris-Cl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.2 M NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Nucleosome Core Particle: 1.2 M NaCl, 50% sucrose, 50ms - 10s time resolved data",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Ithaca, NY, United States",
"full_name": "Cornell University",
"webpage": "https://www.cornell.edu/"
}
],
"contributor_name": "Yujie",
"contributor_surname": "Chen",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-04-14",
"storage_temperature": 0.0,
"cell_temperature": 20.0,
"exposure_time": 0.01,
"number_of_frames": 5,
"wavelength": 0.125,
"sample_detector_distance": 2.5,
"concentration_min": null,
"concentration_max": 3.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.06,
"s_max": 1.95,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "From the depositor:\r\n\"Protein signal is blanked out in 50% sucrose, only DNA contributes to the scattering. Hence, the SAXS profile reports the Rg and molecule weight of the DNA in the nucleosome core particle complex.\"",
"experiment_description": "Synchrotron SAXS data from solutions of Nucleasome Core Particle in 20 mM Tris-HCl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.2 M NaCl, pH 7.5, were collected on the 18ID beam line at the Advanced Photon Source (APS), Argonne National Laboratory (Lemont, IL, USA) using a Pilatus 100K detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.125 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 20°C through a time-course spanning 50 ms to 10 s (with a 50 ms delay time). The data displayed in this entry represent the scattering after 50 ms; the remaining data from the time series can be located in the full-entry zip archive.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 184.0,
"experimental_mw_error": null,
"guinier_i0_mw": 84.01,
"guinier_i0_mw_error": 1.7,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 307000.0,
"guinier_i0_error": 12400.0,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 5.81,
"guinier_rg_error": 0.38,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 11,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBS7_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
