Bovine serum albumin monomer (measured by SEC-SAXS)

{
  "code": "SASDBT4",
  "status": "Published",
  "type_of_curve": "Other",
  "angular_unit": "1/nm",
  "project": {
    "title": "Bovine Serum Albumin measured by SEC-SAXS",
    "publication": null,
    "status": "released",
    "submitted_date": "2016-04-11",
    "released_date": "2016-04-14"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBT4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBT4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBT4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBT4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Bovine serum albumin, monomer",
          "short_name": "BSA monomer",
          "sequence": "DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFA\r\nKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNE\r\nCFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYA\r\nPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCA\r\nSIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLL\r\nECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPEN\r\nLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAK\r\nEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEY\r\nGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTED\r\nYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKA\r\nFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENF\r\nVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA",
          "organism": "Bos taurus",
          "uniprot_code": "P02769",
          "uniprot_range_first": 25,
          "uniprot_range_last": 607,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF\nDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP\nERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY\nANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA\nRLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE\nCCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR\nHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK\nLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL\nNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP\nDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV\nSTQTALA",
          "mw": 66.462,
          "total_mw": 66.462,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris 142 mM NaCl 5 % Glycerol 1mM DTT",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "142 mM NaCl, 5 % Glycerol, 1mM DTT",
        "concentration": 20.0,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Bovine serum albumin monomer (measured by SEC-SAXS)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "EMBL",
            "address": "Grenoble, France",
            "full_name": "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation",
            "webpage": "https://www.embl.fr/"
          }
        ],
        "contributor_name": "Martha",
        "contributor_surname": "Brennich",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2016-02-22",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 40,
    "wavelength": 0.93,
    "sample_detector_distance": 2.43,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.132,
    "s_max": 4.865,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBT4_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "3v03",
              "ext_code": "3V03",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDBT4_fit1_model1.pdb",
          "model_mw": 62.38,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 119
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBT4_fit1_fixed_fit_img.png",
      "software": null,
      "chi_square_value": 2.41,
      "p_value": 0.0,
      "fit_residual_plot": "SASDBT4_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBT4_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of monomeric bovine serum albumin in 20 mM Tris, 142 mM NaCl, 5 % Glycerol, 1mM DTT, pH 7 were collected on the BM29 SAXS beam line at the ESRF (Grenoble, France) using a 2D Photon counting Pilatus 1M-W pixel detector  (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.099 nm). Forty successive 1 s frames were collected through a BSA elution peak from a size-exclusion chromatography column (GE Healthcare Superdex 200 10/300 GL at 0.5 ml/min; initial load concentration = 10 mg/ml). The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank (derived from the SEC running solvent) was subtracted and the individual solvent-corrected SAXS profiles were scaled and averaged.",
  "tags": [
    "benchmark"
  ],
  "intensity_unit": null,
  "experimental_mw": 58.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 69.0,
  "porod_mw_error": null,
  "pddf_i0": 152.1,
  "pddf_i0_error": 0.04,
  "guinier_i0": 150.78,
  "guinier_i0_error": 0.072,
  "pddf_rg": 2.77,
  "pddf_rg_error": 0.008,
  "guinier_rg": 2.71,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 8.15,
  "pddf_dmax_error": null,
  "porod_volume": 118.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 45,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBT4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-08-17T10:26:30.598958+02:00",
  "bragg_peak": []
}

{
  "code": "SASDBT4",
  "status": "success",
  "started_at": "2026-08-11T14:30:41.396367+00:00",
  "finished_at": "2026-08-11T14:30:51.247399+00:00",
  "source_last_modified": "2020-08-17T10:26:30.598958+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBT4/",
      "path": "/data/saxsdb/sasbdb/entries/t4/sasdbt4/source/summary.json",
      "size": 8141,
      "sha256": "07178ba9a6199764fdb513b8c191051a4f1664184d60bd11e0c25398ff436cd3"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBT4.dat",
      "path": "/data/saxsdb/sasbdb/entries/t4/sasdbt4/source/SASDBT4.dat",
      "size": 49463,
      "sha256": "73ae9b2c97dcfa67aca8985cce985d4772aaffb0b93d2b690c3f0175ffa2bbe4",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBT4.out",
      "path": "/data/saxsdb/sasbdb/entries/t4/sasdbt4/source/SASDBT4.out",
      "size": 64642,
      "sha256": "7aa3f8f0bf5f8303e5920d97450d88a2910774712ba8a19d5e79eb9662997f1d",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBT4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/t4/sasdbt4/source/SASDBT4.sascif",
      "size": 581620,
      "sha256": "7ac203eb21c0cd3108fd9e9daf7f8faeed183116d8f2e0aa88320b14566024f5",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBT4.zip",
      "path": "/data/saxsdb/sasbdb/entries/t4/sasdbt4/source/SASDBT4.zip",
      "size": 136216,
      "sha256": "e8f38ad4f80c9fea3d6623def73b7fe84cfbac8b145108b65f675ae8060091a1",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}