The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBV4",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "The N Terminus of the Vaccinia Virus Protein F1L Is an Intrinsically Unstructured Region That Is Not Involved in Apoptosis Regulation.",
"publication": {
"title": "The N Terminus of the Vaccinia Virus Protein F1L Is an Intrinsically Unstructured Region That Is Not Involved in Apoptosis Regulation.",
"author_list": "Caria S, Marshall B, Burton RL, Campbell S, Pantaki-Eimany D, Hawkins CJ, Barry M, Kvansakul M",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.M116.726851",
"pmid": "27151220",
"published_date": "2016 Jul 8"
},
"status": "released",
"submitted_date": "2016-04-11",
"released_date": "2016-09-22"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBV4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBV4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBV4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBV4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBV4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBV4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBV4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "MVA F1L antiapoptotic Bcl-2 viral protein",
"short_name": "MVA F1L (Protein F1)",
"sequence": "MGSSHHHHHHSQDPMLSMFMCNNIVDYVDGIVQDIEDEASNNVDHDYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVRYYMSKQRLDDLYRQLPTKTRSYIDIINIYCDKVSNDYNRDMNIMYDMASTKSFTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVKTIKMFTLLSHTICDDCFVDYITDISPPDNTIPNTSTREYLK",
"organism": "Vaccinia virus",
"uniprot_code": "O57173",
"uniprot_range_first": 1,
"uniprot_range_last": 202,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MLSMFMCNNIVDYVDGIVQDIEDEASNNVDHDYVYPLPENMVYRFDKSTNILDYLSTERD\nHVMMAVRYYMSKQRLDDLYRQLPTKTRSYIDIINIYCDKVSNDYNRDMNIMYDMASTKSF\nTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVKTIKMFTLLSHTICDDCFVD\nYITDISPPDNTIPNTSTREYLKLIGITAIMFATYKTLKYMIG",
"mw": 25.291,
"total_mw": 50.583,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM HEPES 150 mM NaCl 5 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Vaccinia virus MVA F1L antiapoptotic Bcl-2 viral protein",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Sofia",
"contributor_surname": "Caria",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2016-04-15",
"storage_temperature": 20.0,
"cell_temperature": null,
"exposure_time": 1.0,
"number_of_frames": 18,
"wavelength": null,
"sample_detector_distance": 1.6,
"concentration_min": 0.12,
"concentration_max": 3.6,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.196,
"s_max": 5.16,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBV4_fit1_model1_img.png",
"software": "BUNCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBV4_fit1_model1.pdb",
"model_mw": 49.57,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/B5.log",
"symmetry": "",
"comment": "",
"user": 123
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBV4_fit1_fit_img.png",
"software": null,
"chi_square_value": 7.3,
"p_value": 0.0,
"fit_residual_plot": "SASDBV4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBV4_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBV4_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBV4_fit2_model1.pdb",
"model_mw": 49.57,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/C5.log",
"symmetry": "",
"comment": "",
"user": 123
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBV4_fit2_fit_img.png",
"software": null,
"chi_square_value": 3.8,
"p_value": 0.0,
"fit_residual_plot": "SASDBV4_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBV4_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Vaccinia virus MVA F1L antiapoptotic Bcl-2 viral protein in 25 mM HEPES, 150 mM NaCl, 5 mM DTT, pH 7.5 were collected on the SAXS/WAXS camera on the storage ring Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 1.6 m (I(s) vs s = 4π sin θ/λ, where 2θ is the scattering angle). Solute concentrations ranging between 0.1 and 3.6 mg/ml were measured. 18 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected were obtained from a single concentration scattering curve.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 51.7,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 0.0735086,
"guinier_i0_error": null,
"pddf_rg": 3.68,
"pddf_rg_error": null,
"guinier_rg": 3.41,
"guinier_rg_error": null,
"pddf_dmax": 16.2,
"pddf_dmax_error": null,
"porod_volume": 74.36,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBV4_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBV4",
"status": "success",
"started_at": "2026-08-11T14:32:03.922398+00:00",
"finished_at": "2026-08-11T14:32:12.909412+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBV4/",
"path": "/data/saxsdb/sasbdb/entries/v4/sasdbv4/source/summary.json",
"size": 8614,
"sha256": "eecf6e4e9ad30ee2eaa85d2e66dacc5030bf3d3b2352466a1bc161bc7749b2b1"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBV4.dat",
"path": "/data/saxsdb/sasbdb/entries/v4/sasdbv4/source/SASDBV4.dat",
"size": 35779,
"sha256": "de5c823d64c8d4fd03fb536db94215c3c08b171092ae60db6c0bb55eb1d496c8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBV4.out",
"path": "/data/saxsdb/sasbdb/entries/v4/sasdbv4/source/SASDBV4.out",
"size": 35323,
"sha256": "425cb16fdecaf8389c27d368721a413c4f393e2a042e9219bb08a8907b8806f9",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBV4.sascif",
"path": "/data/saxsdb/sasbdb/entries/v4/sasdbv4/source/SASDBV4.sascif",
"size": 633535,
"sha256": "c42a16ddd71e82e9230851d202de34216d79b647ea938efc4934d05b1e9fad1a",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBV4.zip",
"path": "/data/saxsdb/sasbdb/entries/v4/sasdbv4/source/SASDBV4.zip",
"size": 207962,
"sha256": "6cc4b2a4ded86c83cd03d63d84c843f7c9218828e2fc05ddc39e0b9a2fa41f5f",
"role": "full_entry_zip",
"zip_member_count": 8,
"zip_validation": "central_directory_readable"
}
]
}
