The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBZ6",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Structural Basis for Draxin-Modulated Axon Guidance and Fasciculation by Netrin-1 through DCC.",
"publication": {
"title": "Structural Basis for Draxin-Modulated Axon Guidance and Fasciculation by Netrin-1 through DCC.",
"author_list": "Liu Y, Bhowmick T, Liu Y, Gao X, Mertens HDT, Svergun DI, Xiao J, Zhang Y, Wang JH, Meijers R",
"journal": "Neuron",
"doi": "10.1016/j.neuron.2018.02.010",
"pmid": "29503192",
"published_date": "2018 Mar 21"
},
"status": "released",
"submitted_date": "2016-10-10",
"released_date": "2017-11-06"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBZ6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBZ6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Draxin",
"short_name": "Draxin",
"sequence": "MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPGLPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHKRRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINVGAPLEGSENLYFQGSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKGAHHHHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "Q8NBI3",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRR\nGPGKKEWGPGLPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYP\nEKENRPPGWERTRKRSREHKRRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEES\nSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYED\nLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGL\nNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV",
"mw": 44.5,
"total_mw": 44.5,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": "150 mM NaCl",
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Draxin",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-08-19",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 1.24,
"sample_detector_distance": 3.1,
"concentration_min": 0.3,
"concentration_max": 1.2,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.022,
"s_max": 4.82,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model1_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model1.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_001_1_Xrzv1xx.log",
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model2_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model2.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model3_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model3.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model4_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model4.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model5_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model5.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ6_fit1_model6_img.png",
"software": "EOM/GAJOE",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ6_fit1_model6.pdb",
"model_mw": 36.29,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "ensemble conformer",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBZ6_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.055,
"p_value": 0.1026,
"fit_residual_plot": "fit4columns1256_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBZ6_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_METYmvX.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM (5.0)",
"i0_calibration_standard": null,
"description": "Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway",
"experiment_description": null,
"tags": [
"idp"
],
"intensity_unit": null,
"experimental_mw": 44.0,
"experimental_mw_error": null,
"guinier_i0_mw": 44.0,
"guinier_i0_mw_error": 5.0,
"porod_mw": 51.0,
"porod_mw_error": null,
"pddf_i0": 0.03,
"pddf_i0_error": 0.001,
"guinier_i0": 0.032,
"guinier_i0_error": 0.001,
"pddf_rg": 4.43,
"pddf_rg_error": 0.1,
"guinier_rg": 4.2,
"guinier_rg_error": 0.1,
"pddf_dmax": 15.0,
"pddf_dmax_error": 0.5,
"porod_volume": 87.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 35,
"guinier_point_last": 105,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBZ6_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
