The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC28",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/A",
"project": {
"title": "The atypical thiol-disulfide exchange protein α-DsbA2 from Wolbachia pipientis is a homotrimeric disulfide isomerase.",
"publication": {
"title": "The atypical thiol-disulfide exchange protein α-DsbA2 from Wolbachia pipientis is a homotrimeric disulfide isomerase.",
"author_list": "Walden PM, Whitten AE, Premkumar L, Halili MA, Heras B, King GJ, Martin JL",
"journal": "Acta Crystallogr D Struct Biol",
"doi": "10.1107/S2059798318018442",
"pmid": "30950399",
"published_date": "2019 Mar 1"
},
"status": "released",
"submitted_date": "2017-10-03",
"released_date": "2019-03-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC28.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC28.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC28_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC28_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC28_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC28_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC28.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DsbA-like disulfide oxidoreductase (thiol-disulfide exchange protein)",
"short_name": "α-DsbA2",
"sequence": "SNAMSLPIINNWLSNRSQMLNDDYIGEKLDNYISRNFDKIVKTLKEESIKSSYAARDNV\r\nTKSKISQYKDQIFDLTYPYSGNENSSVIAVGFLDYSCGHCKAIKNDIKQLINDGKIKYIFRDAPILGNAS\r\nLKAAKSALAVYFLNKEKYFDFHHAALSHKGEFSDESILDIVKNIGIDEDDFNDSIKDNADKIEQMINNSR\r\nLLVRDLGVGGTPFLIIGDSLFVGATDLNVLRKKVDELSHKQG",
"organism": "Wolbachia endosymbiont of Drosophila melanogaster",
"uniprot_code": "Q73FL6",
"uniprot_range_first": 16,
"uniprot_range_last": 252,
"oligomerization": "trimer",
"molecular_type": "protein",
"uniprot_sequence": "MSRISFLLILIIAIASLPIINNWLSNRSQMLNDDYIGEKLDNYISRNFDKIVKTLKEESI\nKSSYAARDNVTKSKISQYKDQIFDLTYPYSGNENSSVIAVGFLDYSCGHCKAIKNDIKQL\nINDGKIKYIFRDAPILGNASLKAAKSALAVYFLDKEKYFDFHHAALSHKGEFSDESILDI\nVKNIGIDEDDFNDSIKDNADKIEQMINNSRLLVRDLGVGGTPFLIIGDSLFVGATDLNVL\nRKKVDELSHKQG",
"mw": 27.071,
"total_mw": 81.213,
"number_molecules": 3,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM TRIS, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Mature α-DsbA2 protein",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Andrew",
"contributor_surname": "Whitten",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-03-29",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 5.0,
"number_of_frames": 8,
"wavelength": 0.1127,
"sample_detector_distance": 1.575,
"concentration_min": 0.35,
"concentration_max": 1.15,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.103,
"s_max": 3.992,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC28_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC28_fit1_model1.pdb",
"model_mw": 52.625,
"bead_radius": 2.5,
"log": "https://www.sasbdb.org/media/log_files/damsel_0WumaPk.log",
"symmetry": "P3",
"comment": "Filtered model from Damaver",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC28_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.199,
"p_value": 0.26545,
"fit_residual_plot": "SASDC28_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC28_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run0_YE1wuMC.log",
"software_version": "5.3",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC28_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC28_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": "P3",
"comment": "",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC28_fit2_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.37,
"p_value": 0.0371,
"fit_residual_plot": "SASDC28_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC28_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run10.log",
"software_version": "1.1",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from the mature version of α-DsbA2 from Wolbachia pipientis in 25 mM TRIS 150mM NaCl pH 7.5 were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) in a SEC-SAXS configuration using a 2D Photon counting Pilatus 1M-W pixel detector (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle; λ=0.1127 nm). Approximately 100 uL of 19.8 mg/ml protein solution were injected onto a WTC-030S5 column at a flow rate of 0.5 ml/min. Five hundred successive 5 second frames were collected during the SEC-SAXS run. The peak of the elution profile occured at ~18 mins after the start of the run, and the protein scattering was taken as the average of 8 frames collected 35-75 seconds after the peak eluted (the radius of gyration dropped to ~27.6 Ang at the peak concentration of ~2.2 mg/ml, so data was averaged at a region where the concentration was lower and concentration dependent effects were not apparent). The concentration range corresponding to the averaged frames was ~0.35 - 1.15 mg/ml, and the average concentration was taken as ~0.75 mg/ml. The buffer was taken as the sum of 100 frames collected between 3-9 mins after the start of the run. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The models and corresponding fits include those derived from dummy-atom modelling using DAMMIN (top) and rigid-body modelling using CORAL (bottom).",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 86.7,
"experimental_mw_error": null,
"guinier_i0_mw": 86.7,
"guinier_i0_mw_error": 5.0,
"porod_mw": 75.0,
"porod_mw_error": null,
"pddf_i0": 0.04845,
"pddf_i0_error": 2e-05,
"guinier_i0": 0.04846,
"guinier_i0_error": 3e-05,
"pddf_rg": 2.79,
"pddf_rg_error": 0.01,
"guinier_rg": 2.8,
"guinier_rg_error": 0.01,
"pddf_dmax": 8.7,
"pddf_dmax_error": 3.0,
"porod_volume": 913.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 30,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC28_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-04-10T09:53:07.171187+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC28",
"status": "success",
"started_at": "2026-08-11T15:43:52.330202+00:00",
"finished_at": "2026-08-11T15:44:01.274874+00:00",
"source_last_modified": "2021-04-10T09:53:07.171187+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC28/",
"path": "/data/saxsdb/sasbdb/entries/28/sasdc28/source/summary.json",
"size": 9624,
"sha256": "789a621e2324acc1158c1315f6f1aea6a6c99a8133ffd1867652b0606bb0654b"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC28.dat",
"path": "/data/saxsdb/sasbdb/entries/28/sasdc28/source/SASDC28.dat",
"size": 14887,
"sha256": "9e9391d611b37d1b9ab899e113c104618a95f06f52acb4bd2eab14cb4194daa4",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC28.out",
"path": "/data/saxsdb/sasbdb/entries/28/sasdc28/source/SASDC28.out",
"size": 26506,
"sha256": "61bbb7d1e4cd0565c78f5d387351ef4efec63ad839d87eb7a1b2370799367d0a",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC28.sascif",
"path": "/data/saxsdb/sasbdb/entries/28/sasdc28/source/SASDC28.sascif",
"size": 760615,
"sha256": "3c46af1e8a7db54fa638a075fd5f896a4c8ad9457584ca2eeed374d4c2bce7a0",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC28.zip",
"path": "/data/saxsdb/sasbdb/entries/28/sasdc28/source/SASDC28.zip",
"size": 123210,
"sha256": "afc8690cc55392d55d670d8a4ca913324b0ede3eab6679d49a61be5b32ebb796",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
