The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC34",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Biophysical investigation of type A PutAs reveals a conserved core oligomeric structure.",
"publication": {
"title": "Biophysical investigation of type A PutAs reveals a conserved core oligomeric structure.",
"author_list": "Korasick DA, Singh H, Pemberton TA, Luo M, Dhatwalia R, Tanner JJ",
"journal": "FEBS J",
"doi": "10.1111/febs.14165",
"pmid": "28710792",
"published_date": "2017 Sep"
},
"status": "released",
"submitted_date": "2017-05-19",
"released_date": "2017-07-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC34.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC34.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC34_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC34_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC34_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC34_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC34.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Proline dehydrogenase",
"short_name": "BjPutA R51E",
"sequence": "GHMPNIPPPFTAPYAPDDAEIAARLLPASHLSPPQEARIHRTATRLIEAIRKEDDRLGGVEDMLREFALSTKEGLALMVL\r\nAEALLRVPDARTADQFIEDKLGEGDFIHHETKSTAFLVNASAWALGLSARVIQPGETPDGTIGRLVKRLGAPAVRTATRQ\r\nAMRLMGNHFVLGETIEQALERGKPRSGQKTRYSFDMLGEGARTAADARRYFDAYASAIETIGKAAGNHALPDRPGISVKL\r\nSALHPRFEAISRARVMVELVPQLLDLAQRAKAHDLNFTVDAEEADRLELSLDVIAATLADPSLKGWDGFGLAIQAYQKRA\r\nSAVIDYVDALARAHDRKLMVRLVKGAYWDTEIKRAQERGLDGYPVFTRKAMTDLNYVACASKLLALRPRIFPQFATHNAL\r\nTVATVLEMAEGSSGFEFQRLHGMGEALYEQLAKDHADIAYRTYAPVGSHRDLLAYLVRRLLENGANSSFVAQAADYRVPV\r\nPALLQRPADAIVRPQAAAHPRIPLPCDLFAPERRNSRGVEFGARTALDQLLTDVKAETGDLKPIADATPDQAHAAVAAAR\r\nAGFAGWSRTPAGIRAAALEQAAHLLESRSAHFIALLQREGGKTLDDALSELREAADFCRYYAAQGRKLFGSETAMPGPTG\r\nESNALTMRGRGVFVAISPWNFPLAIFLGQVTAALMAGNSVVAKPAEQTPRIAREAVALLHEAGIPKSALYLVTGDGRIGA\r\nALTAHPDIAGVVFTGSTEVARSINRALAAKDGPIVPLIAETGGINAMIADATALPEQVADDVVTSAFRSAGQRCSALRLL\r\nFVQEDVADRMIEMVAGAARELKIGDPSDVATHVGPVIDVEAKQRLDAHIARMKTEARLHFAGPAPEGCFVAPHIFELTEA\r\nGQLTEEVFGPILHVVRYRPENLERVLRAIERTGYGLTLGVHSRIDDSIEAIIDRVQVGNIYVNRNMIGAVVGVQPFGGNG\r\nLSGTGPKAGGPHYLARFATEQTVTINTAAAGGNAALLAGEE",
"organism": "Bradyrhizobium diazoefficiens",
"uniprot_code": "Q89E26",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MPNIPPPFTAPYAPDDAEIAARLLPASHLSPPQEARIHRTATRLIEAIRKRDDRLGGVED\nMLREFALSTKEGLALMVLAEALLRVPDARTADQFIEDKLGEGDFIHHETKSTAFLVNASA\nWALGLSARVIQPGETPDGTIGRLVKRLGAPAVRTATRQAMRLMGNHFVLGETIEQALERG\nKPRSGQKTRYSFDMLGEGARTAADARRYFDAYASAIETIGKAAGNHALPDRPGISVKLSA\nLHPRFEAISRARVMVELVPQLLDLAQRAKAHDLNFTVDAEEADRLELSLDVIAATLADPS\nLKGWDGFGLAIQAYQKRASAVIDYVDALARAHDRKLMVRLVKGAYWDTEIKRAQERGLDG\nYPVFTRKAMTDLNYVACASKLLALRPRIFPQFATHNALTVATVLEMAEGSSGFEFQRLHG\nMGEALYEQLAKDHADIAYRTYAPVGSHRDLLAYLVRRLLENGANSSFVAQAADYRVPVPA\nLLQRPADAIVRPQAAAHPRIPLPCDLFAPERRNSRGVEFGARTALDQLLTDVKAETGDLK\nPIADATPDQAHAAVAAARAGFAGWSRTPAGIRAAALEQAAHLLESRSAHFIALLQREGGK\nTLDDALSELREAADFCRYYAAQGRKLFGSETAMPGPTGESNALTMRGRGVFVAISPWNFP\nLAIFLGQVTAALMAGNSVVAKPAEQTPRIAREAVALLHEAGIPKSALYLVTGDGRIGAAL\nTAHPDIAGVVFTGSTEVARSINRALAAKDGPIVPLIAETGGINAMIADATALPEQVADDV\nVTSAFRSAGQRCSALRLLFVQEDVADRMIEMVAGAARELKIGDPSDVATHVGPVIDVEAK\nQRLDAHIARMKTEARLHFAGPAPEGCFVAPHIFELTEAGQLTEEVFGPILHVVRYRPENL\nERVLRAIERTGYGLTLGVHSRIDDSIEAIIDRVQVGNIYVNRNMIGAVVGVQPFGGNGLS\nGTGPKAGGPHYLARFATEQTVTINTAAAGGNAALLAGEE",
"mw": 107.531,
"total_mw": 215.062,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris (pH 7.8), 50 mM NaCl, 0.5 mM Tris(2-carboxyethyl)phosphine, and 5% (v/v) glycerol",
"concentration_unit": null,
"comment": "BjPutA buffer",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.8,
"deuteration": null
},
"purity_method": null,
"name": "Proline utilization A from Bradyrhizobium diazoefficiens (formerly Bradyrhizobium japonicum) R51E mutant 7.0 mg/mL",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "Mizzou",
"address": "Columbia, MO, USA",
"full_name": "University of Missouri-Columbia",
"webpage": "http://missouri.edu/"
}
],
"contributor_name": "John",
"contributor_surname": "Tanner",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-12-16",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 7.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.131,
"s_max": 3.244,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC34_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC34_fit1_model1.pdb",
"model_mw": 173.0,
"bead_radius": 3.1,
"log": null,
"symmetry": "P2",
"comment": "",
"user": 166
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC34_fit1_model2_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.0 r6293",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC34_fit1_model2.pdb",
"model_mw": 172.646,
"bead_radius": 5.0,
"log": null,
"symmetry": "",
"comment": "",
"user": 166
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC34_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.29,
"p_value": 0.0,
"fit_residual_plot": "SASDC34_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC34_fit1.fir",
"fit_log": null,
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Proline utilization A from Bradyrhizobium diazoefficiens (formerly Bradyrhizobium japonicum) R51E mutant in 50 mM Tris, 50 mM NaCl, 0.5 mM Tris(2-carboxyethyl)phosphine, and 5% (v/v) glycerol, pH 7.8 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a a Pilatus3 X 2M detector. One solute concentration of 7 mg/ml was measured. The data were normalized to the intensity of the transmitted beam and radially averaged. The radially averaged scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 216.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 357.0,
"pddf_i0_error": 0.7,
"guinier_i0": 355.79,
"guinier_i0_error": 3.34,
"pddf_rg": 4.59,
"pddf_rg_error": 0.01,
"guinier_rg": 4.5,
"guinier_rg_error": 0.04,
"pddf_dmax": 14.6,
"pddf_dmax_error": null,
"porod_volume": 289.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 27,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC34_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-18T10:06:35.099964+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC34",
"status": "success",
"started_at": "2026-08-11T14:12:45.005942+00:00",
"finished_at": "2026-08-11T14:12:54.034346+00:00",
"source_last_modified": "2026-05-18T10:06:35.099964+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC34/",
"path": "/data/saxsdb/sasbdb/entries/34/sasdc34/source/summary.json",
"size": 9547,
"sha256": "f8e48a98c54a9bc26a661202b7b476819610db75a24bfbee92538b4cc1f811b6"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC34.dat",
"path": "/data/saxsdb/sasbdb/entries/34/sasdc34/source/SASDC34.dat",
"size": 23085,
"sha256": "eb35039fd864b04cfb96a5c02905fd558e3b54a55be5276bb27853a0c4251fb3",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC34.out",
"path": "/data/saxsdb/sasbdb/entries/34/sasdc34/source/SASDC34.out",
"size": 47867,
"sha256": "71104dea5716f8d2e91462767e855a9e7904fb5cd4b90bc29db6d2c7b7acdf0f",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC34.sascif",
"path": "/data/saxsdb/sasbdb/entries/34/sasdc34/source/SASDC34.sascif",
"size": 334693,
"sha256": "a2d6fbf5a4d4c6d03b782ecc119fa789c0e8bcc594c8c0374df32d24e8554401",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC34.zip",
"path": "/data/saxsdb/sasbdb/entries/34/sasdc34/source/SASDC34.zip",
"size": 69919,
"sha256": "acece0d67c73f70d4103f17e74fa3e7b435216f09a9dfd5beffa7f1c7f59a98a",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
