The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC38",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "The atypical thiol-disulfide exchange protein α-DsbA2 from Wolbachia pipientis is a homotrimeric disulfide isomerase.",
"publication": {
"title": "The atypical thiol-disulfide exchange protein α-DsbA2 from Wolbachia pipientis is a homotrimeric disulfide isomerase.",
"author_list": "Walden PM, Whitten AE, Premkumar L, Halili MA, Heras B, King GJ, Martin JL",
"journal": "Acta Crystallogr D Struct Biol",
"doi": "10.1107/S2059798318018442",
"pmid": "30950399",
"published_date": "2019 Mar 1"
},
"status": "released",
"submitted_date": "2017-10-03",
"released_date": "2019-03-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC38.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC38.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC38_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC38_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC38_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC38_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC38.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DsbA-like disulfide oxidoreductase (thiol-disulfide exchange protein)",
"short_name": "α-DsbA2",
"sequence": "SNAARDNVTKSKISQYKDQIFDLTYPYSGNENSSVIAVGFLDYSCGHCKAIKNDIKQLINDGKIKYIFRDAPILGNASLKAAKSALAVYFLNKEKYFDFHHAALSHKGEFSDESILDIVKNIGIDEDDFNDSIKDNADKIEQMINNSR\r\nLLVRDLGVGGTPFLIIGDSLFVGATDLNVLRKKVDELSHKQG",
"organism": "Wolbachia endosymbiont of Drosophila melanogaster",
"uniprot_code": "Q73FL6",
"uniprot_range_first": 65,
"uniprot_range_last": 252,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSRISFLLILIIAIASLPIINNWLSNRSQMLNDDYIGEKLDNYISRNFDKIVKTLKEESI\nKSSYAARDNVTKSKISQYKDQIFDLTYPYSGNENSSVIAVGFLDYSCGHCKAIKNDIKQL\nINDGKIKYIFRDAPILGNASLKAAKSALAVYFLDKEKYFDFHHAALSHKGEFSDESILDI\nVKNIGIDEDDFNDSIKDNADKIEQMINNSRLLVRDLGVGGTPFLIIGDSLFVGATDLNVL\nRKKVDELSHKQG",
"mw": 21.091,
"total_mw": 21.093,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM TRIS, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Truncated α-DsbA2 protein",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Andrew",
"contributor_surname": "Whitten",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2012-02-29",
"storage_temperature": 4.0,
"cell_temperature": 10.0,
"exposure_time": 2.0,
"number_of_frames": 8,
"wavelength": 0.1033,
"sample_detector_distance": 1.575,
"concentration_min": 1.25,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.1,
"s_max": 3.996,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC38_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC38_fit1_model1.pdb",
"model_mw": 19.264,
"bead_radius": 1.75,
"log": "https://www.sasbdb.org/media/log_files/damsel_sJi2sTc.log",
"symmetry": "P1",
"comment": "Filtered model from Damaver",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC38_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.034,
"p_value": 0.247123,
"fit_residual_plot": "SASDC38_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC38_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run0_FAZDfOb.log",
"software_version": "5.3",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC38_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [
{
"pdb_code": "6eez",
"ext_code": "6eez",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "1.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC38_fit2_model1.pdb",
"model_mw": 21.13,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/run8.log",
"symmetry": "P1",
"comment": "",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC38_fit2_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 3.88,
"p_value": 0.0,
"fit_residual_plot": "SASDC38_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC38_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run8.log",
"software_version": "1.1",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from the truncated version of α-DsbA2 from Wolbachia pipientis in 25 mM TRIS 150mM NaCl pH 7.5 were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) using a 2D Photon counting Pilatus 1M-W pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). Eight successive 2 second frames were collected across solute concentrations of 1.25-5.00 mg/ml. The SAXS data displayed this entry was derived from a 1.25 mg/ml sample. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The models and corresponding fits include those derived from dummy-atom modelling using DAMMIN (top) and rigid-body modelling using CORAL (bottom).",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 23.0,
"experimental_mw_error": null,
"guinier_i0_mw": 23.0,
"guinier_i0_mw_error": 1.0,
"porod_mw": 23.0,
"porod_mw_error": null,
"pddf_i0": 0.0215,
"pddf_i0_error": 0.0001,
"guinier_i0": 0.0215,
"guinier_i0_error": 0.0001,
"pddf_rg": 1.88,
"pddf_rg_error": 0.01,
"guinier_rg": 1.87,
"guinier_rg_error": 0.01,
"pddf_dmax": 6.3,
"pddf_dmax_error": 0.3,
"porod_volume": 275.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 45,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC38_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-04-10T09:53:41.823307+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC38",
"status": "success",
"started_at": "2026-08-11T15:44:39.400067+00:00",
"finished_at": "2026-08-11T15:44:50.889042+00:00",
"source_last_modified": "2021-04-10T09:53:41.823307+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC38/",
"path": "/data/saxsdb/sasbdb/entries/38/sasdc38/source/summary.json",
"size": 9237,
"sha256": "d16c8b33e7b3942b5fff85319a2ed23aedbe2c62b084361ab1fa7b360f82ca2b"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC38.dat",
"path": "/data/saxsdb/sasbdb/entries/38/sasdc38/source/SASDC38.dat",
"size": 13766,
"sha256": "3145e3ccd788695e8282a82327480647bb42b318649774837e6d373183522ccd",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC38.out",
"path": "/data/saxsdb/sasbdb/entries/38/sasdc38/source/SASDC38.out",
"size": 25117,
"sha256": "378ca6f328e5776997d8f9dd37e39ea3ffeac1dae161f2dec2f8a24a7d8f2a1e",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC38.sascif",
"path": "/data/saxsdb/sasbdb/entries/38/sasdc38/source/SASDC38.sascif",
"size": 341601,
"sha256": "e900ac723781c910f9d5eb780c6e6aab2975449e61068f7413e55671a546aca3",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC38.zip",
"path": "/data/saxsdb/sasbdb/entries/38/sasdc38/source/SASDC38.zip",
"size": 60309,
"sha256": "3c31f7b60bd6a0e5bb35694bd8377a2ad6f7e4cc121095354f59da39c4fc7bd0",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
