The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC46",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/A",
"project": {
"title": "Structural and functional dissection of the DH and PH domains of oncogenic Bcr-Abl tyrosine kinase.",
"publication": {
"title": "Structural and functional dissection of the DH and PH domains of oncogenic Bcr-Abl tyrosine kinase.",
"author_list": "Reckel S, Gehin C, Tardivon D, Georgeon S, Kükenshöner T, Löhr F, Koide A, Buchner L, Panjkovich A, Reynaud A, Pinho S, Gerig B, Svergun D, Pojer F, Güntert P, Dötsch V, Koide S, Gavin AC, Hantschel O",
"journal": "Nat Commun",
"doi": "10.1038/s41467-017-02313-6",
"pmid": "29235475",
"published_date": "2017 Dec 13"
},
"status": "released",
"submitted_date": "2017-07-10",
"released_date": "2018-01-03"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC46.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC46.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC46_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC46_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC46_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC46_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC46.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "BCR-ABL p210 fusion protein (PH domain)",
"short_name": null,
"sequence": "GAMGEHRQLLKDSFMVELVEGAR\r\nKLRHVFLFTDLLLCTKLKKQ\r\nSGGKTQQYDCKWYIPLTDLS\r\nFQMVDELEAVPNIPLVPDEE\r\nLDALKIKISQIKNDIQREKR\r\nANKGSKATERLKKKLSEQES\r\nLLLLMSPSMAFRVHSRNGKS\r\nYTFLISSDYERAEWRENIRE\r\nQQKKCFRSFSLTSVELQMLT\r\nNSCVKLQTVH",
"organism": "Homo sapiens",
"uniprot_code": "P11274",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ\nTLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE\nGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV\nEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC\nGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ\nSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY\nRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG\nAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG\nALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS\nQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV\nAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL\nLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE\nGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP\nDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN\nGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN\nKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE\nEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI\nAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER\nRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF\nTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL\nHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS\nKRQSILFSTEV",
"mw": 22.413,
"total_mw": 22.413,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM Tris-HCl, 150 mM NaCl, 5% Glycerol, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "PH - Pleckstrin-homology domain of Bcr-Abl tyrosine kinase p210",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Alejandro",
"contributor_surname": "Panjkovich",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-11-10",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.045,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": 1.0,
"concentration_max": 9.14,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.021,
"s_max": 3.79,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC46_fit1_model1_img.png",
"software": "SREFLEX",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "2.8.1",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC46_fit1_model1.pdb",
"model_mw": 19.02,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 145
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC46_fit1_fit_img.png",
"software": "SREFLEX",
"chi_square_value": 1.1,
"p_value": 0.026281,
"fit_residual_plot": "SASDC46_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC46_fit1.fit",
"fit_log": null,
"software_version": "2.8.1",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The homology model is derived from PDB ID: 2z0q. The PDB entry for BCR-ABL p210 fusion protein PH domain is 5oc7 (has an internal deletion).",
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 23.0,
"experimental_mw_error": null,
"guinier_i0_mw": 16.0,
"guinier_i0_mw_error": 3.0,
"porod_mw": 23.0,
"porod_mw_error": null,
"pddf_i0": 2074.0,
"pddf_i0_error": 9.0,
"guinier_i0": 2071.9,
"guinier_i0_error": 9.84,
"pddf_rg": 2.07,
"pddf_rg_error": 0.02,
"guinier_rg": 2.04,
"guinier_rg_error": 0.03,
"pddf_dmax": 6.6,
"pddf_dmax_error": 0.3,
"porod_volume": 38.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 26,
"guinier_point_last": 296,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC46_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDC46",
"status": "success",
"started_at": "2026-08-11T15:01:18.511740+00:00",
"finished_at": "2026-08-11T15:01:28.646641+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC46/",
"path": "/data/saxsdb/sasbdb/entries/46/sasdc46/source/summary.json",
"size": 8173,
"sha256": "d39f01528ed12e7f7365a694ab2cf54a638d7351f751ce95d6d80bbd5c55bb89"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDC46.dat",
"path": "/data/saxsdb/sasbdb/entries/46/sasdc46/source/SASDC46.dat",
"size": 81512,
"sha256": "332f49504541fd36620a8177f0bd0cafb51c6d67e0dad97f45ce5f5e6a26d1d2",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDC46.out",
"path": "/data/saxsdb/sasbdb/entries/46/sasdc46/source/SASDC46.out",
"size": 127996,
"sha256": "1317fc56d7804318053883376e34f5f03c4f1c785118e5b99b2a1517f785f909",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC46.sascif",
"path": "/data/saxsdb/sasbdb/entries/46/sasdc46/source/SASDC46.sascif",
"size": 405658,
"sha256": "24752b4a7d4980ca25bca519f04b4dbd96b85f899c5a5518aae4f029d10bee78",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDC46.zip",
"path": "/data/saxsdb/sasbdb/entries/46/sasdc46/source/SASDC46.zip",
"size": 108267,
"sha256": "21f0da9051fb7ec80d4c93e3fe7dde929d6d6ad5b1d0ab9835d5f69dd9ed4058",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
