Streptococcus pneumoniae phosphodiesterase Pde2

{
  "code": "SASDCB7",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
    "publication": {
      "title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
      "author_list": "Drexler DJ, Müller M, Rojas-Cordova CA, Bandera AM, Witte G",
      "journal": "Structure",
      "doi": "10.1016/j.str.2017.10.001",
      "pmid": "29107484",
      "published_date": "2017 Dec 5"
    },
    "status": "released",
    "submitted_date": "2017-09-01",
    "released_date": "2017-10-31"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCB7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCB7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCB7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCB7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCB7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "DHH subfamily 1 protein",
          "short_name": "SpnPde2",
          "sequence": "SMEICQQILEKIKEYDTIIIHRHMKPDPDALGSQVGLKALLEHHFPEKTIKAVGFDEPTLT\r\nWMAEMDLVEDRAYQGALVIVCDTANTARIDDKRYSQGDFLIKIDHHPNDDVYGDLSWVDT\r\nSSSSASEMITLFAQTTQLALADRDAELLFAGIVGDTGRFLYPSTTARTLRLAAYLREHNF\r\nDFAALTRKMDTMSYKIAKLQGYIYDHLEVDENGAARVILSQEVLKQYNVTDAETAAIVGA\r\nPGRIDRVSLWGIFVEQADGHYRVRLRSKIHPINEIAKEHDGGGHPLASGANSYSLEENEI\r\nIYQKLKNLLKN",
          "organism": "Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)",
          "uniprot_code": "A0A0H2ZNP2",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEICQQILEKIKEYDTIIIHRHMKPDPDALGSQVGLKALLEHHFPEKTIKAVGFDEPTLT\nWMAEMDLVEDRAYQGALVIVCDTANTARIDDKRYSQGDFLIKIDHHPNDDVYGDLSWVDT\nSSSSASEMITLFAQTTQLALADRDAELLFAGIVGDTGRFLYPSTTARTLRLAAYLREHNF\nDFAALTRKMDTMSYKIAKLQGYIYDHLEVDENGAARVILSQEVLKQYNVTDAETAAIVGA\nPGRIDRVSLWGIFVEQADGHYRVRLRSKIHPINEIAKEHDGGGHPLASGANSYSLEENEI\nIYQKLKNLLKN",
          "mw": 35.053,
          "total_mw": 70.106,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20mM Tris, 200 mM NaCl,  5%(v/v) glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Streptococcus pneumoniae phosphodiesterase Pde2",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Munich, Germany",
            "full_name": "Ludwig-Maximilians-Universität München",
            "webpage": "https://www.en.uni-muenchen.de"
          }
        ],
        "contributor_name": "Gregor",
        "contributor_surname": "Witte",
        "orcid": "https://orcid.org/0000-0003-0313-0962"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-06-23",
    "storage_temperature": null,
    "cell_temperature": 20.0,
    "exposure_time": 0.045,
    "number_of_frames": 39,
    "wavelength": 0.123987,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 7.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.027,
    "s_max": 4.808,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Streptococcus pneumoniae phosphodiesterase Pde2 in 20mM Tris, 200 mM NaCl, 5%(v/v) glycerol, pH 7.5, were collected on the EMBL-P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123987 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). One solute concentration of 7.00 mg/ml was measured at 20°C. 39 successive 0.045 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 57.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 67.0,
  "porod_mw_error": null,
  "pddf_i0": 21410.0,
  "pddf_i0_error": 13.4,
  "guinier_i0": 21234.0,
  "guinier_i0_error": 19.57,
  "pddf_rg": 2.72,
  "pddf_rg_error": 0.148,
  "guinier_rg": 2.69,
  "guinier_rg_error": 0.23,
  "pddf_dmax": 7.74,
  "pddf_dmax_error": null,
  "porod_volume": 86.56,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 14,
  "guinier_point_last": 146,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCB7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDCB7",
  "status": "success",
  "started_at": "2026-08-11T15:25:49.975211+00:00",
  "finished_at": "2026-08-11T15:26:00.013718+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCB7/",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasdcb7/source/summary.json",
      "size": 6720,
      "sha256": "1273388b5ede2a13b449c3e96a53043a5ad00d1ceb7c058556c79670afe1e3b0"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCB7.dat",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasdcb7/source/SASDCB7.dat",
      "size": 83543,
      "sha256": "4049130fd965284cef9577ca40bd382b0abcc60a3a72066bcd127af4f7bcd853",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCB7.out",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasdcb7/source/SASDCB7.out",
      "size": 97561,
      "sha256": "8850dfba7fada1446daf0aed9cc9cf05a51673d40ae24ed41e4c854a1baf0c57",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCB7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasdcb7/source/SASDCB7.sascif",
      "size": 161927,
      "sha256": "61506e01551200c21fa89070f57bd72ef7c71eecf957b4794bdac714d77a35b0",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCB7.zip",
      "path": "/data/saxsdb/sasbdb/entries/b7/sasdcb7/source/SASDCB7.zip",
      "size": 47515,
      "sha256": "c6f30dab8b274eddd11b89b63c2577dfc25eec4bd0368aaf5f30b3fcf0645904",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}