Thermotoga martitima phosphodiesterase TM1595 D80N D154N (inactive mutant)

{
  "code": "SASDCC7",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
    "publication": {
      "title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
      "author_list": "Drexler DJ, Müller M, Rojas-Cordova CA, Bandera AM, Witte G",
      "journal": "Structure",
      "doi": "10.1016/j.str.2017.10.001",
      "pmid": "29107484",
      "published_date": "2017 Dec 5"
    },
    "status": "released",
    "submitted_date": "2017-09-01",
    "released_date": "2017-10-31"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCC7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCC7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCC7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCC7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "T.maritima PDE",
          "short_name": "TmPDE D80N D154N",
          "sequence": "GSGSGMDEIVKVLSQHDRILVVGHIMPDGDCVSSVLSLTLGLEKLGKEVKAAVDYKIPYVFEKFPYIDKIEENPNFDPELLVVVNASSPDRIGKFQDLLDKVPSVVIDHHSTNTNFGNWNWVDPSFAATAQMIFRINKALGVEYDSNLATLNYLGIATNTGFFRHSNADVRVFEDAYKLVKMGADAHFVAKEILENKRFEQFKLFAEVLERLQLLENGKIAYSYIDYDTYLRHNCTDEDSAGFVGELRSIRGVEVAVLFMEFPRGKIHVSMRSKDWFNVNEVAFELGGGGHPRAAGVTFEGKKIEEVIPRVINHLLKKFKEGVESESEKIPEGDVLGG",
          "organism": "Thermotoga maritima",
          "uniprot_code": "Q9X1T1",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDEIVKVLSQHDRILVVGHIMPDGDCVSSVLSLTLGLEKLGKEVKAAVDYKIPYVFEKFP\nYIDKIEENPNFDPELLVVVDASSPDRIGKFQDLLDKVPSVVIDHHSTNTNFGNWNWVDPS\nFAATAQMIFRINKALGVEYDSNLATLNYLGIATDTGFFRHSNADVRVFEDAYKLVKMGAD\nAHFVAKEILENKRFEQFKLFAEVLERLQLLENGKIAYSYIDYDTYLRHNCTDEDSAGFVG\nELRSIRGVEVAVLFMEFPRGKIHVSMRSKDWFNVNEVAFELGGGGHPRAAGVTFEGKKIE\nEVIPRVINHLLKKFKEGVESESEKIPEGDVLGG",
          "mw": 37.821,
          "total_mw": 75.642,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25mM Tris 500mM NaCl 3% (v/v) glycerol 2mM MgCl2",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Thermotoga martitima phosphodiesterase TM1595 D80N D154N (inactive mutant)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Munich, Germany",
            "full_name": "Ludwig-Maximilians-Universität München",
            "webpage": "https://www.en.uni-muenchen.de"
          }
        ],
        "contributor_name": "Gregor",
        "contributor_surname": "Witte",
        "orcid": "https://orcid.org/0000-0003-0313-0962"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-06-17",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.995,
    "number_of_frames": null,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.0,
    "s_max": 2.927,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Thermotoga martitima phosphodiesterase TM1595 D80N D154N (inactive mutant) in 25mM Tris 500mM NaCl 3% (v/v) glycerol 2mM MgCl2, pH 8, were collected on the EMBL-P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). Samples were collected using SEC-SAXS at 20°C. The scattering was obtained by averaging the main peak's scattering data of a SECSAXS run with TmPDE D80ND154N on a 10/300 S200 superdex column. The data was corrected for buffer scattering by subtraction of an averaged buffer region using the CHROMIXS software (ATSAS 2.8.1).",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 72.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 69.2,
  "porod_mw_error": null,
  "pddf_i0": 9314.0,
  "pddf_i0_error": null,
  "guinier_i0": 9293.71,
  "guinier_i0_error": 6.68,
  "pddf_rg": 2.78,
  "pddf_rg_error": null,
  "guinier_rg": 2.79,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 7.9,
  "pddf_dmax_error": null,
  "porod_volume": 115.38,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 54,
  "guinier_point_last": 175,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCC7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDCC7",
  "status": "success",
  "started_at": "2026-08-11T15:26:28.759599+00:00",
  "finished_at": "2026-08-11T15:26:37.283729+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCC7/",
      "path": "/data/saxsdb/sasbdb/entries/c7/sasdcc7/source/summary.json",
      "size": 6770,
      "sha256": "d6e19ba0a60b1339d5a2a0b766ee9ae6a507c4136e29c9828e2b873faf86abfe"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCC7.dat",
      "path": "/data/saxsdb/sasbdb/entries/c7/sasdcc7/source/SASDCC7.dat",
      "size": 42286,
      "sha256": "386f40ab0235be8825536ba4eb3daa5fd5abea676b7f9572eab5116910585013",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCC7.out",
      "path": "/data/saxsdb/sasbdb/entries/c7/sasdcc7/source/SASDCC7.out",
      "size": 115207,
      "sha256": "f941675d99bb2fae7c1d3aa4f87169a0f387ee6166f15343912f313540a9d9cc",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCC7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/c7/sasdcc7/source/SASDCC7.sascif",
      "size": 145926,
      "sha256": "9b6e28fb3447c59759f7bb490f24aa43bae63a98b87e584a87974647ae3e72ec",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCC7.zip",
      "path": "/data/saxsdb/sasbdb/entries/c7/sasdcc7/source/SASDCC7.zip",
      "size": 34465,
      "sha256": "34f0191b89657ffbe7cb605be44059da1f8e58fa4f75da12b880b94339c3c4e4",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}