Nanolipoprotein Particle (NLP) from In Vitro Assembly - 42% D2O SANS

{
  "code": "SASDCC9",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.",
    "publication": {
      "title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.",
      "author_list": "Cleveland TE 4th, He W, Evans AC, Fischer NO, Lau EY, Coleman MA, Butler P",
      "journal": "Protein Sci",
      "doi": "10.1002/pro.3365",
      "pmid": "29266475",
      "published_date": "2018 Mar"
    },
    "status": "released",
    "submitted_date": "2017-11-21",
    "released_date": "2018-01-09"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCC9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCC9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCC9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCC9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCC9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "640x640 mm 3He posn sensitive prop counter",
        "name": "Ordela 2660N",
        "resolution": 5.08
      },
      "name": "NIST Center for High Resolution Neutron Scattering (CHRNS)",
      "city": "Gaithersburg, MD",
      "country": "USA",
      "beamline_name": "NGB 30m SANS",
      "beam_geometry": null,
      "type_of_source": "neutron source",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Apolipoprotein A-I",
          "short_name": "ApoA-I",
          "sequence": "MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ",
          "organism": "Mus musculus",
          "uniprot_code": "Q00623",
          "uniprot_range_first": 67,
          "uniprot_range_last": 264,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSS\nLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKV\nQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVD\nSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLM\nPMLETLKTQVQSVIDKASETLTAQ",
          "mw": 25.153,
          "total_mw": 50.306,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "1,2-dimyristoyl-sn-glycero-3-phosphocholine",
          "short_name": "DMPC",
          "sequence": "N/A",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "other",
          "molecular_type": "other",
          "uniprot_sequence": null,
          "mw": 0.678,
          "total_mw": 92.0,
          "number_molecules": 0,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "PBS in 42% D2O",
        "concentration_unit": null,
        "comment": "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in 42% D2O with no further pH adjustment",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 42% D2O SANS",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "NIST",
            "address": "Gaithersburg, MD, USA",
            "full_name": "National Institute of Standards and Technology (NIST)",
            "webpage": "https://www.nist.gov/"
          }
        ],
        "contributor_name": "Thomas",
        "contributor_surname": "Cleveland",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-12-11",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 3600.0,
    "number_of_frames": 2,
    "wavelength": 0.6,
    "sample_detector_distance": 4.0,
    "concentration_min": null,
    "concentration_max": 0.96,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.1,
    "s_max": 4.768,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Additional SANS measurement parameters. Two detector positions (in m) and count times (s) were employed: 1.33 m (two frames of 900 + 831 = 1731 s total count time); 4 m (two frames of 3600 + 3600 = 7200 s total count time).",
  "experiment_description": "Small-angle neutron scattering (SANS) data from solutions of Nanolipoprotein Particle (NLP) from In Vitro Assembly in PBS constituted in 42% D2O, pH/D 7.4, were collected on the NGB30 instrument at the NIST Center for Neutron Research (Gaithersburg, MD, USA) using a 640x640 mm 3He posn sensitive Ordela 2660N detector at a wavelength of λ = 0.6 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 0.96 mg/ml was measured at 25°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 142.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.043,
  "pddf_i0_error": 0.001,
  "guinier_i0": 0.044,
  "guinier_i0_error": 0.00084,
  "pddf_rg": 2.87,
  "pddf_rg_error": 0.06,
  "guinier_rg": 2.91,
  "guinier_rg_error": 0.19,
  "pddf_dmax": 7.27,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 28,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDCC9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2022-08-15T15:13:30.873638+02:00",
  "bragg_peak": []
}

{
  "code": "SASDCC9",
  "status": "success",
  "started_at": "2026-08-11T16:11:09.820086+00:00",
  "finished_at": "2026-08-11T16:11:16.800713+00:00",
  "source_last_modified": "2022-08-15T15:13:30.873638+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCC9/",
      "path": "/data/saxsdb/sasbdb/entries/c9/sasdcc9/source/summary.json",
      "size": 7448,
      "sha256": "851f48224581696d6ae8ba99d147ff2947cc720efa7d498bae23e37a0d33fe86"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDCC9.dat",
      "path": "/data/saxsdb/sasbdb/entries/c9/sasdcc9/source/SASDCC9.dat",
      "size": 7146,
      "sha256": "23e07f044fe4f7672e95e053cd588750d226c7493662f359eb3216ee5fe9e852",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDCC9.out",
      "path": "/data/saxsdb/sasbdb/entries/c9/sasdcc9/source/SASDCC9.out",
      "size": 13288,
      "sha256": "b2aee6abc81add41e7fb71058f55b400d4a1da988da44959f6f1a62d6759f276",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCC9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/c9/sasdcc9/source/SASDCC9.sascif",
      "size": 23351,
      "sha256": "f01d27f5ea991761dda04aa804b882a88d39010f849145f0f390e24b1de0ec44",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDCC9.zip",
      "path": "/data/saxsdb/sasbdb/entries/c9/sasdcc9/source/SASDCC9.zip",
      "size": 5170,
      "sha256": "b2f955e0c382dc0f9f8eea4d4f7a707b4e951d8488fffeb6a5c8acb6200f2f5d",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}