The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDCD7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
"publication": {
"title": "Structural and Biophysical Analysis of the Soluble DHH/DHHA1-Type Phosphodiesterase TM1595 from Thermotoga maritima.",
"author_list": "Drexler DJ, Müller M, Rojas-Cordova CA, Bandera AM, Witte G",
"journal": "Structure",
"doi": "10.1016/j.str.2017.10.001",
"pmid": "29107484",
"published_date": "2017 Dec 5"
},
"status": "released",
"submitted_date": "2017-09-01",
"released_date": "2017-10-31"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDCD7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCD7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCD7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCD7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDCD7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCD7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCD7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Thermotoga maritima phosphodiesterase (wildtype, TmPDE, TM1595)",
"short_name": "TmPde",
"sequence": "GSGSGMDEIVKVLSQHDRILVVGHIMPDGDCVSSVLSLTLGLEKLGKEVKAAVDYKIPYVFEKFPYIDKIEENPNFDPELLVVVDASSPDRIGKFQDLLDKVPSVVIDHHSTNTNFGNWNWVDPSFAATAQMIFRINKALGVEYDSNLATLNYLGIATDTGFFRHSNADVRVFEDAYKLVKMGADAHFVAKEILENKRFEQFKLFAEVLERLQLLENGKIAYSYIDYDTYLRHNCTDEDSAGFVGELRSIRGVEVAVLFMEFPRGKIHVSMRSKDWFNVNEVAFELGGGGHPRAAGVTFEGKKIEEVIPRVINHLLKKFKEGVESESEKIPEGDVLGG",
"organism": "Thermotoga maritima",
"uniprot_code": "Q9X1T1",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MDEIVKVLSQHDRILVVGHIMPDGDCVSSVLSLTLGLEKLGKEVKAAVDYKIPYVFEKFP\nYIDKIEENPNFDPELLVVVDASSPDRIGKFQDLLDKVPSVVIDHHSTNTNFGNWNWVDPS\nFAATAQMIFRINKALGVEYDSNLATLNYLGIATDTGFFRHSNADVRVFEDAYKLVKMGAD\nAHFVAKEILENKRFEQFKLFAEVLERLQLLENGKIAYSYIDYDTYLRHNCTDEDSAGFVG\nELRSIRGVEVAVLFMEFPRGKIHVSMRSKDWFNVNEVAFELGGGGHPRAAGVTFEGKKIE\nEVIPRVINHLLKKFKEGVESESEKIPEGDVLGG",
"mw": 37.823,
"total_mw": 75.646,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20mM Tris, 200 mM NaCl, 5%(v/v) glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Thermotoga maritima phosphodiesterase TM1595 (wildtype, TmPde)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Munich, Germany",
"full_name": "Ludwig-Maximilians-Universität München",
"webpage": "https://www.en.uni-muenchen.de"
}
],
"contributor_name": "Gregor",
"contributor_surname": "Witte",
"orcid": "https://orcid.org/0000-0003-0313-0962"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-06-23",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 0.045,
"number_of_frames": 34,
"wavelength": 0.123987,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 7.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.061,
"s_max": 3.192,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDCD7_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "5o25",
"ext_code": "5O25",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDCD7_fit1_model1.pdb",
"model_mw": 73.82,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/TmPDE-apo_ready-submit00.log.log",
"symmetry": "",
"comment": "PDB not yet released",
"user": 229
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDCD7_fit1_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.3,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1072_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDCD7_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/TmPDE-apo_ready-submit00.log.log",
"software_version": "2.8",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0 (r6345)",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Thermotoga maritima phosphodiesterase TM1595 (wildtype, TmPde) in 20mM Tris, 200 mM NaCl, 5%(v/v) glycerol, pH 7.5, were collected on the EMBL-P12 beam line on the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123987 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). One solute concentration of 7.00 mg/ml was measured at 20°C. 34 successive 0.045 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 67.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 64.0,
"porod_mw_error": null,
"pddf_i0": 20030.0,
"pddf_i0_error": 16.4,
"guinier_i0": 19766.0,
"guinier_i0_error": 20.06,
"pddf_rg": 2.73,
"pddf_rg_error": 0.002,
"guinier_rg": 2.67,
"guinier_rg_error": 0.01,
"pddf_dmax": 7.76,
"pddf_dmax_error": null,
"porod_volume": 105.9,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 130,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCD7_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDCD7",
"status": "success",
"started_at": "2026-08-11T15:27:13.891920+00:00",
"finished_at": "2026-08-11T15:27:24.124014+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCD7/",
"path": "/data/saxsdb/sasbdb/entries/d7/sasdcd7/source/summary.json",
"size": 8166,
"sha256": "98df74a023cfe925e27fe0f6b2d363e56cd35dcdde3509b02ab31edef2ae34a8"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCD7.dat",
"path": "/data/saxsdb/sasbdb/entries/d7/sasdcd7/source/SASDCD7.dat",
"size": 56275,
"sha256": "60a50774c1dcdb8772656e5755fbaafbacb5449f8459edde76db1e9288fbb062",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDCD7.out",
"path": "/data/saxsdb/sasbdb/entries/d7/sasdcd7/source/SASDCD7.out",
"size": 105438,
"sha256": "f4f2987c2398ca868b15774a1a3fe1742e0e39d1fa90e035320d0b5737736275",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCD7.sascif",
"path": "/data/saxsdb/sasbdb/entries/d7/sasdcd7/source/SASDCD7.sascif",
"size": 711496,
"sha256": "aca1537dac79becdbffe8d4d7c1a6ee5a914b7476de95ce90e5b458d966e7acb",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCD7.zip",
"path": "/data/saxsdb/sasbdb/entries/d7/sasdcd7/source/SASDCD7.zip",
"size": 280268,
"sha256": "34e388c8d23e026709e942c61d5f201200b4787643a8405c8b4edcc646c5a2fb",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
