The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.dat",
"role": "curve",
"sha256": "4c15a4c62c44ac736f3c12786ff1cad53cc691981f1ce7b721bc84f7dbe748dd",
"size": 15779,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCX4.dat"
} full_entry_zip：source record and ZIP contents (1 items) {
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.zip",
"role": "full_entry_zip",
"sha256": "960c00639ec4ae610b59c37ce0b8f843ebcf2cc451164e1d7f15fbd869f24170",
"size": 3145,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCX4.zip",
"zip_member_count": 1,
"zip_members": [
{
"crc32": "0cace524",
"name": "SASDCX4/experimental_data/SASDCX4.dat",
"size": 15779
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.out",
"role": "pddf",
"status": "not_listed"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.sascif",
"role": "sascif",
"sha256": "e31e29359f84975b38e574a49c592fc631b82b1bb9ad7fa54a677f15b50ba986",
"size": 33194,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCX4.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/summary.json",
"sha256": "7af8c2cd27cb86c72f18732d748a931260b82659e06e5aef2bc87fc07dd8d121",
"size": 8925,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCX4/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：134 field values manifest.json：33 field values View the complete summary.json source {
"code": "SASDCX4",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil.",
"publication": {
"title": "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil.",
"author_list": "Planelles-Herrero VJ, Hartman JJ, Robert-Paganin J, Malik FI, Houdusse A",
"journal": "Nat Commun",
"doi": "10.1038/s41467-017-00176-5",
"pmid": "28775348",
"published_date": "2017 Aug 4"
},
"status": "released",
"submitted_date": "2017-06-07",
"released_date": "2018-01-23"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDCX4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX4_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDCX4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCX4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Bovine β Cardiac Myosin S1 fragment",
"short_name": "BCS1 (myosin-7)",
"sequence": "MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT\r\nAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL\r\nFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES\r\nGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN\r\nSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM\r\nLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG\r\nNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV\r\nVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF\r\nTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF\r\nPKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP\r\nLNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT\r\nNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ\r\nRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER\r\nLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWP\r\nMAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE\r\nAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP\r\nMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ\r\nEDSNGCINYEAFVKHIMAG",
"organism": "Bos taurus",
"uniprot_code": "Q9BE39",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT\nAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL\nFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES\nGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN\nSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM\nLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG\nNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV\nVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF\nTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF\nPKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP\nLNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT\nNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ\nRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER\nLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL\nKSAETEKEIALMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD\nAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT\nLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL\nTKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL\nKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS\nRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV\nAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR\nSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE\nEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI\nQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA\nALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR\nENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEQEEGKILR\nAQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG\nDLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL\nLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTE\nVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA\nEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN\nLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL\nRAKSRDIGTKGLNEE",
"mw": 116.582,
"total_mw": 116.582,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM HEPES, 50 mM NaCl, 1 mM NaN3, 2.5 mM MgCl2, 2 mM ADP, 1 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP+OM",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Paris, France",
"full_name": "Institut Curie",
"webpage": "https://institut-curie.org/"
}
],
"contributor_name": "Vicente José",
"contributor_surname": "Planelles Herrero",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2016-03-01",
"storage_temperature": 4.0,
"cell_temperature": null,
"exposure_time": 0.5,
"number_of_frames": 40,
"wavelength": 0.10332,
"sample_detector_distance": 1.786,
"concentration_min": null,
"concentration_max": 4.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.199,
"s_max": 3.06,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "BATCH mode",
"experiment_description": "Synchrotron SAXS data from solutions of Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP+OM in 10 mM HEPES, 50 mM NaCl, 1 mM NaN3, 2.5 mM MgCl2, 2 mM ADP, 1 mM TCEP, pH 7.5 were collected on the SWING beam line SOLEIL (Saint-Aubin, France) using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.10332 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 4.00 mg/ml was measured. 40 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 119.14,
"experimental_mw_error": null,
"guinier_i0_mw": 119.14,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.14,
"pddf_i0_error": null,
"guinier_i0": 0.15,
"guinier_i0_error": 0.0002,
"pddf_rg": 3.8,
"pddf_rg_error": null,
"guinier_rg": 3.99,
"guinier_rg_error": 0.04,
"pddf_dmax": 11.5,
"pddf_dmax_error": null,
"porod_volume": 161.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 14,
"guinier_point_last": 38,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDCX4_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDCX4",
"status": "success",
"started_at": "2026-08-11T14:33:36.329979+00:00",
"finished_at": "2026-08-11T14:33:42.327221+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDCX4/",
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/summary.json",
"size": 8925,
"sha256": "7af8c2cd27cb86c72f18732d748a931260b82659e06e5aef2bc87fc07dd8d121"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDCX4.dat",
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.dat",
"size": 15779,
"sha256": "4c15a4c62c44ac736f3c12786ff1cad53cc691981f1ce7b721bc84f7dbe748dd",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDCX4.sascif",
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.sascif",
"size": 33194,
"sha256": "e31e29359f84975b38e574a49c592fc631b82b1bb9ad7fa54a677f15b50ba986",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDCX4.zip",
"path": "/data/saxsdb/sasbdb/entries/x4/sasdcx4/source/SASDCX4.zip",
"size": 3145,
"sha256": "960c00639ec4ae610b59c37ce0b8f843ebcf2cc451164e1d7f15fbd869f24170",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
} 
