The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD22",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"publication": {
"title": "Cryptic Disorder Out of Disorder: Encounter between Conditionally Disordered CP12 and Glyceraldehyde-3-Phosphate Dehydrogenase.",
"author_list": "Launay H, Barré P, Puppo C, Zhang Y, Maneville S, Gontero B, Receveur-Bréchot V",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2018.02.020",
"pmid": "29501381",
"published_date": "2018 Apr 13"
},
"status": "released",
"submitted_date": "2017-12-04",
"released_date": "2018-03-11"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD22.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD22.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD22_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD22_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD22_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD22_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD22.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Calvin cycle protein CP12, chloroplastic",
"short_name": "CP12",
"sequence": "HHHHHHHHHHSSGHIEGRHMSGQPAVDLNKKVQDAVKEAEDACAKGTSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFCKDAPDADECRVYED",
"organism": "Chlamydomonas reinhardtii",
"uniprot_code": "A6Q0K5",
"uniprot_range_first": 28,
"uniprot_range_last": 107,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MMLTKSVVISRPAVRPVSTRRAVVVRASGQPAVDLNKKVQDAVKEAEDACAKGTSADCAV\nAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFCKDAPDADECRVYED",
"mw": 10.934,
"total_mw": 10.934,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Glyceraldehyde-3-phosphate dehydrogenase",
"short_name": "GAPDH",
"sequence": "EKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKWVA",
"organism": "Chlamydomonas reinhardtii",
"uniprot_code": "A8HP84",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MAAMMQKSAFTGSAVSSKSGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQ\nNTLLDVVAINDSGGVKQASHLLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQ\nLPWKEMNIDLVIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKH\nEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA\nLNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFR\nEAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR\nVVDLAEVTAKKWVA",
"mw": 36.881,
"total_mw": 147.524,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "30 mM Tris, 4 mM EDTA, 100 µM NAD, 5 mM free cysteine",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.9,
"deuteration": null
},
"purity_method": null,
"name": "Glyceraldehyde-3-phosphate dehydrogenase in complex with oxidised chloroplastic calvin cycle protein CP12 (C. reinhardtii)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marseille, France",
"full_name": "Aix Marseille Univ, CNRS, BIP UMR7281",
"webpage": "http://bip.cnrs-mrs.fr"
}
],
"contributor_name": "Veronique",
"contributor_surname": "Receveur-Brechot",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2010-12-08",
"storage_temperature": 15.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 250,
"wavelength": 0.1033,
"sample_detector_distance": 1.832,
"concentration_min": null,
"concentration_max": 16.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.105,
"s_max": 4.595,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD22_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 5.291,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1223_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD22_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_8Gj01w3.log",
"software_version": null,
"description": null
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD22_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 29.721,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1224_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD22_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Size_distr_003_1.dat",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Glyceraldehyde-3-phosphate dehydrogenase in complex with oxidised chloroplastic calvin cycle protein CP12 in 30 mM Tris, 4 mM EDTA, 100 µM NAD, 5 mM free cysteine, pH 7.9 were collected on the SWING beam line at the SOLEIL storage ring (Saint-Aubin, France) using a CCD AVIEX detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 16.00 mg/ml was measured at 20°C. 250 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 166.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.0003877,
"pddf_i0_error": 2e-07,
"guinier_i0": 0.0003852,
"guinier_i0_error": 1e-08,
"pddf_rg": 3.99,
"pddf_rg_error": 0.006,
"guinier_rg": 3.84,
"guinier_rg_error": 0.01,
"pddf_dmax": 19.0,
"pddf_dmax_error": 1.0,
"porod_volume": 250.82,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 31,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD22_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:27:27.968395+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDD22",
"status": "success",
"started_at": "2026-08-11T13:28:49.310425+00:00",
"finished_at": "2026-08-11T13:28:57.853621+00:00",
"source_last_modified": "2020-08-28T15:27:27.968395+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD22/",
"path": "/data/saxsdb/sasbdb/entries/22/sasdd22/source/summary.json",
"size": 8902,
"sha256": "37da982c8b765ac20cc0297025768889cd5427e397ab12023f5b32b99013fc76"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD22.dat",
"path": "/data/saxsdb/sasbdb/entries/22/sasdd22/source/SASDD22.dat",
"size": 37476,
"sha256": "657e77e205e77ccabf13e6cf269534f8ebe6b9f356a31c171d30c071237d4b50",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD22.out",
"path": "/data/saxsdb/sasbdb/entries/22/sasdd22/source/SASDD22.out",
"size": 33246,
"sha256": "53149a6b8189fb37feab480d44d85f55577c112909b1a1c7cc538dfe0db21cd1",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD22.sascif",
"path": "/data/saxsdb/sasbdb/entries/22/sasdd22/source/SASDD22.sascif",
"size": 158548,
"sha256": "b59ecdec36ec79143442b1d669ea0893584a81df7d5da84775704f88e0255d55",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD22.zip",
"path": "/data/saxsdb/sasbdb/entries/22/sasdd22/source/SASDD22.zip",
"size": 45145,
"sha256": "63fc9b30346428d40b3356a403edc86260fc06cb85edf4c9c219631fb525af4f",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
