The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDD75",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "'TG' interacting factor",
"publication": null,
"status": "released",
"submitted_date": "2018-03-21",
"released_date": "2019-11-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD75.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD75.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD75_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD75_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD75_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD75_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD75.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Homeobox protein TGIF1",
"short_name": "TGIF",
"sequence": ">TGIF1\r\nGPMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISE",
"organism": "Homo sapiens",
"uniprot_code": "Q15583",
"uniprot_range_first": 151,
"uniprot_range_last": 248,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYL\nPPAPWSSLATPSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGA\nQGPAPRRRLLETMKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILR\nDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTIS\nRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPS\nVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSG\nLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA",
"mw": 11.709,
"total_mw": 23.418,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "'TG'-interacting factor homeodomain in solution (Homeobox protein TGIF1)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "IRB",
"address": "Barcelona, Spain",
"full_name": "Institute for Research in Biomedicine in Barcelona (IRB)",
"webpage": "https://www.irbbarcelona.org"
}
],
"contributor_name": "Ewelina",
"contributor_surname": "Guca",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-10-18",
"storage_temperature": 10.0,
"cell_temperature": 20.0,
"exposure_time": 0.045,
"number_of_frames": 120,
"wavelength": 0.124,
"sample_detector_distance": 1.5,
"concentration_min": null,
"concentration_max": 6.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.095,
"s_max": 7.901,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD75_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD75_fit1_model1.pdb",
"model_mw": 30.401,
"bead_radius": 2.25,
"log": null,
"symmetry": "P1",
"comment": null,
"user": 292
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD75_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.123,
"p_value": 0.65717,
"fit_residual_plot": "SASDD75_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD75_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/sub_TGIF6mgmL_P1.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD75_fit2_model1_img.png",
"software": "ModLoops",
"pdb_link": [
{
"pdb_code": "6fqq",
"ext_code": "6FQQ",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD75_fit2_model1.pdb",
"model_mw": 23.43,
"bead_radius": null,
"log": null,
"symmetry": "P1",
"comment": "Two monomers (B) and (D) have been used as rigid bodies and N- and C-terminal loops were modelled.",
"user": 292
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD75_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.721,
"p_value": 0.0,
"fit_residual_plot": "SASDD75_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD75_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/06092eommodloops_final.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD75_fit3_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6fqq",
"ext_code": "6FQQ",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD75_fit3_model1.pdb",
"model_mw": 23.43,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_009_1_O6kZPkg.log",
"symmetry": "P1",
"comment": null,
"user": 292
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD75_fit3_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6fqq",
"ext_code": "6FQQ",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD75_fit3_model2.pdb",
"model_mw": 23.43,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_009_1_IwmZKun.log",
"symmetry": "P1",
"comment": null,
"user": 292
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD75_fit3_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6fqq",
"ext_code": "6FQQ",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD75_fit3_model3.pdb",
"model_mw": 23.43,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_009_1_nQQJNLP.log",
"symmetry": "P1",
"comment": null,
"user": 292
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD75_fit3_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.116,
"p_value": 0.198541,
"fit_residual_plot": "SASDD75_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD75_fit3.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_009_1_zXxo4bV.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 25.5,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 26.0,
"porod_mw_error": null,
"pddf_i0": 11350.0,
"pddf_i0_error": null,
"guinier_i0": 11423.2,
"guinier_i0_error": 73.9,
"pddf_rg": 2.753,
"pddf_rg_error": null,
"guinier_rg": 2.7,
"guinier_rg_error": 0.05,
"pddf_dmax": 9.21,
"pddf_dmax_error": null,
"porod_volume": 42.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 74,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD75_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
