The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.dat",
"role": "curve",
"sha256": "7f0bd4f15f6247cdba6adcd8b7ab958d28de5794a47bd6fa03e9579850f00730",
"size": 83545,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD86.dat"
} full_entry_zip：source record and ZIP contents (4 items) {
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.zip",
"role": "full_entry_zip",
"sha256": "119895358774cebef04219e91992073797277258c723bbfdaa8a1bd7c66470a2",
"size": 69277,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD86.zip",
"zip_member_count": 4,
"zip_members": [
{
"crc32": "fc74a6c2",
"name": "SASDD86/experimental_data/SASDD86.dat",
"size": 83545
},
{
"crc32": "3914dc8c",
"name": "SASDD86/pddf/SASDD86.out",
"size": 86047
},
{
"crc32": "b59d690c",
"name": "SASDD86/SASDD86_fit1.fir",
"size": 54434
},
{
"crc32": "ff983209",
"name": "SASDD86/SASDD86_fit1_model1.pdb",
"size": 39882
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.out",
"role": "pddf",
"sha256": "6e174403d43ceea0349525d93563106fe0d90aece92a0aa53bbe707284ddec82",
"size": 86047,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD86.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.sascif",
"role": "sascif",
"sha256": "a9e2c65f5bc2dc439db607d3c5502c884a044b7d6328cab94250f9ca8e6f8a22",
"size": 253127,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD86.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/summary.json",
"sha256": "1ea1231dc6cf7ba7220a2d0dfe9d2dbde6302a47500588517fdf8eff298a1d06",
"size": 8417,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD86/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：156 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDD86",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural analysis of human NHLRC2, mutations of which are associated with FINCA disease.",
"publication": {
"title": "Structural analysis of human NHLRC2, mutations of which are associated with FINCA disease.",
"author_list": "Biterova E, Ignatyev A, Uusimaa J, Hinttala R, Ruddock LW",
"journal": "PLoS One",
"doi": "10.1371/journal.pone.0202391",
"pmid": "30138417",
"published_date": "2018"
},
"status": "released",
"submitted_date": "2018-04-18",
"released_date": "2018-08-24"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD86.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD86.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD86_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD86_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD86_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD86_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD86.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "NHL repeat-containing protein 2",
"short_name": "NHLRC2",
"sequence": "MHHHHHHMAAPGGRGRSLSGLLPAQTSLEYALLDAVTQQEKDSLVYQYLQKVDGWEQDLSVPEFPEGLEWLNTEEPISVYKDLCGKIVVLDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPGKVTVDQVTDRLVIADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPISSPWDVVFGTSGSEVQRGDILWIAMAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLASEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGVTWDKKRNLLYVADSYNHKIKVVDPKTKNCTTLAGTGDTNNVTSSSFTESTFNEPGGLCIGENGELLYVADTNNHQIKVMDLETKMVSVLPIFRSENAVVDGPFLVEKQKTLPKLPKSAPSIRLSPVTACAGQTLQFKLRLDLPSGSKLTEGVSSCWFLTAEGNEWLLQGQIAAGDIENISSQPTISLQIPDDCLSLEAIVSVSVFLYYCSADSSACMMKAILFSQPLQITDTQQGCIAPVELRYVF",
"organism": "Homo sapiens",
"uniprot_code": "Q8NBF2",
"uniprot_range_first": 1,
"uniprot_range_last": 726,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAAPGGRGRSLSGLLPAQTSLEYALLDAVTQQEKDSLVYQYLQKVDGWEQDLSVPEFPEG\nLEWLNTEEPISVYKDLCGKIVVLDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHS\nAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIG\nEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPGKVTVDQVTDRLVI\nADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHL\nIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPISSPWDVVFGTSGSEVQRGDILWIAM\nAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLASE\nDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGV\nTWDKKRNLLYVADSYNHKIKVVDPKTKNCTTLAGTGDTNNVTSSSFTESTFNEPGGLCIG\nENGELLYVADTNNHQIKVMDLETKMVSVLPIFRSENAVVDGPFLVEKQKTLPKLPKSAPS\nIRLSPVTACAGQTLQFKLRLDLPSGSKLTEGVSSCWFLTAEGNEWLLQGQIAAGDIENIS\nSQPTISLQIPDDCLSLEAIVSVSVFLYYCSADSSACMMKAILFSQPLQITDTQQGCIAPV\nELRYVF",
"mw": 80.4,
"total_mw": 80.4,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM BisTris, 100 mM NaCl, 2 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "Full-length human NHLRC2 ( NHL repeat-containing protein 2 )",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Finland",
"full_name": "University of Oulu",
"webpage": "https://www.oulu.fi"
}
],
"contributor_name": "Alexander",
"contributor_surname": "Ignatyev",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-07-08",
"storage_temperature": 4.0,
"cell_temperature": 10.0,
"exposure_time": 3.0,
"number_of_frames": 60,
"wavelength": 0.1,
"sample_detector_distance": 4.0,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.039,
"s_max": 3.9,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDD86_fit1_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "DAMFILT5.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDD86_fit1_model1.pdb",
"model_mw": 77.76,
"bead_radius": 3.75,
"log": null,
"symmetry": "P1",
"comment": "12 models were averaged and filtered",
"user": 311
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDD86_fit1_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 2.682,
"p_value": 0.10889,
"fit_residual_plot": "SASDD86_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDD86_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/NHLRC2_4.log",
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of full-length human NHLRC2 (NHL repeat-containing protein 2 ) in 20 mM BisTris, 100 mM NaCl, 2 mM DTT, pH 6.5, were collected on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 4 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 10°C. 60 successive 3 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 71.2,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 71.2,
"porod_mw_error": null,
"pddf_i0": 0.3031,
"pddf_i0_error": 0.0011,
"guinier_i0": 0.3008,
"guinier_i0_error": 0.0004,
"pddf_rg": 3.76,
"pddf_rg_error": 0.027,
"guinier_rg": 3.59,
"guinier_rg_error": 0.1,
"pddf_dmax": 14.69,
"pddf_dmax_error": null,
"porod_volume": 121.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 14,
"guinier_point_last": 143,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDD86_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDD86",
"status": "success",
"started_at": "2026-08-11T15:03:44.368910+00:00",
"finished_at": "2026-08-11T15:03:53.438414+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDD86/",
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/summary.json",
"size": 8417,
"sha256": "1ea1231dc6cf7ba7220a2d0dfe9d2dbde6302a47500588517fdf8eff298a1d06"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDD86.dat",
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.dat",
"size": 83545,
"sha256": "7f0bd4f15f6247cdba6adcd8b7ab958d28de5794a47bd6fa03e9579850f00730",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDD86.out",
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.out",
"size": 86047,
"sha256": "6e174403d43ceea0349525d93563106fe0d90aece92a0aa53bbe707284ddec82",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD86.sascif",
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.sascif",
"size": 253127,
"sha256": "a9e2c65f5bc2dc439db607d3c5502c884a044b7d6328cab94250f9ca8e6f8a22",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDD86.zip",
"path": "/data/saxsdb/sasbdb/entries/86/sasdd86/source/SASDD86.zip",
"size": 69277,
"sha256": "119895358774cebef04219e91992073797277258c723bbfdaa8a1bd7c66470a2",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
} 
