The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDB8",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Structure and oligomerization of the periplasmic domain of GspL from the type II secretion system of Pseudomonas aeruginosa.",
"publication": {
"title": "Structure and oligomerization of the periplasmic domain of GspL from the type II secretion system of Pseudomonas aeruginosa.",
"author_list": "Fulara A, Vandenberghe I, Read RJ, Devreese B, Savvides SN",
"journal": "Sci Rep",
"doi": "10.1038/s41598-018-34956-w",
"pmid": "30425318",
"published_date": "2018 Nov 13"
},
"status": "released",
"submitted_date": "2018-06-11",
"released_date": "2018-11-13"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDB8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDB8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDB8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDB8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDB8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Type II secretion system protein L, periplasmic domain",
"short_name": "GspLperi",
"sequence": "WSHPQFEKGG GDRYAAQSAE LYRQLFPEDR KLINLRAQFD\r\nQHLADSASSG GEGQLLGLLG QAATVIGGEP TVSVEQLDFS\r\nAARGDVALQV RAPGFDVLER LRSRLSESGL AVQLGSASRD\r\nGSTVSARLVI GG",
"organism": "Pseudomonas aeruginosa",
"uniprot_code": "P25060",
"uniprot_range_first": 261,
"uniprot_range_last": 382,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFAQALAEIRAPWRLYLPVEAVTACA\nVNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA\nEGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR\nAFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG\nLWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG\nGEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL\nAVQLGSASRDGSTVSARLVIGG",
"mw": 13.966,
"total_mw": 27.932,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM TRIS, 100 mM NaCl",
"concentration_unit": null,
"comment": "pH=7.5 at 25°C",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Periplasmic domain of inner membrane protein GspL, dimer",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Gent, Belgium",
"full_name": "Ghent University",
"webpage": "https://www.ugent.be/"
}
],
"contributor_name": "Aleksandra",
"contributor_surname": "Fulara",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-04-08",
"storage_temperature": 4.0,
"cell_temperature": 15.0,
"exposure_time": null,
"number_of_frames": 19,
"wavelength": 0.1033,
"sample_detector_distance": null,
"concentration_min": 2.0,
"concentration_max": 13.7,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.08,
"s_max": 6.139,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model1.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/Ranchweb.log",
"symmetry": "none",
"comment": null,
"user": 331
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model2.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 331
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model3.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 331
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model4_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model4.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 331
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model5_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model5.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 331
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDB8_fit1_model6_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDB8_fit1_model6.pdb",
"model_mw": 27.46,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 331
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDB8_fit1_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 5.788,
"p_value": 0.000794,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDB8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 22.8,
"experimental_mw_error": null,
"guinier_i0_mw": 36.4,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.03865,
"pddf_i0_error": null,
"guinier_i0": 0.0391339,
"guinier_i0_error": 2.5e-05,
"pddf_rg": 2.21,
"pddf_rg_error": null,
"guinier_rg": 2.243,
"guinier_rg_error": 0.07,
"pddf_dmax": 7.5,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDB8_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
