The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDK7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Biophysical insights from a single chain camelid antibody directed against the Disrupted-in-Schizophrenia 1 protein.",
"publication": {
"title": "Biophysical insights from a single chain camelid antibody directed against the Disrupted-in-Schizophrenia 1 protein.",
"author_list": "Yerabham ASK, Müller-Schiffmann A, Ziehm T, Stadler A, Köber S, Indurkhya X, Marreiros R, Trossbach SV, Bradshaw NJ, Prikulis I, Willbold D, Weiergräber OH, Korth C",
"journal": "PLoS One",
"doi": "10.1371/journal.pone.0191162",
"pmid": "29324815",
"published_date": "2018"
},
"status": "released",
"submitted_date": "2018-05-16",
"released_date": "2018-06-05"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDK7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDK7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDK7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDK7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDK7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDK7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDK7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Custom-built",
"name": "Pilatus 1M-W",
"resolution": 0.172
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Disrupted- in-schizophrenia 1 (DISC1 12D2) 691-836",
"short_name": "DISC1 12D2",
"sequence": "MGHHHHHHDYDIPTTENLYFQGWEADLEACRLLIQSLQLQEARGSLSVEDE\r\nRQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELG\r\nEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGSG",
"organism": null,
"uniprot_code": "Q9NRI5",
"uniprot_range_first": 691,
"uniprot_range_last": 836,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPA\nVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGI\nQLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSA\nELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQ\nSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPG\nSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKL\nQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA\nTQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLE\nAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPP\nETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNH\nFWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAY\nETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDER\nQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGE\nKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA\nAASCMTAGVHEAQA",
"mw": 19.426,
"total_mw": 19.426,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM Tris-HCl, 150 mM NaCl, 1mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Disrupted-in-Schizophrenia 1 protein (DISC1 12d2)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Germany",
"full_name": "Forschungszentrum Jülich",
"webpage": "https://www.fz-juelich.de"
}
],
"contributor_name": "Andreas",
"contributor_surname": "Stadler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-10-01",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.095,
"number_of_frames": 20,
"wavelength": 0.123987,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 2.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.049,
"s_max": 4.81,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDK7_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDK7_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDK7_fit1_model2_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.8.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDK7_fit1_model2.pdb",
"model_mw": 14.328,
"bead_radius": 2.5,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/disc_gasbor_18_NY0Oi5w_mRhYFU9_fit_img.png",
"software": "GASBOR",
"chi_square_value": 5.7596,
"p_value": 0.0,
"fit_residual_plot": "disc_gasbor_18_NY0Oi5w_mRhYFU9_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDK7_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/disc_gasbor_18.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDK7_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.8.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDK7_fit2_model1.pdb",
"model_mw": 28.95,
"bead_radius": 2.0,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDK7_fit2_model2_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.8.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDDK7_fit2_model2.pdb",
"model_mw": 28.878,
"bead_radius": 2.5,
"log": null,
"symmetry": null,
"comment": null,
"user": 317
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDK7_fit2_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.170724,
"p_value": 0.000321,
"fit_residual_plot": "SASDDK7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDK7_fit2.fir",
"fit_log": null,
"software_version": "2.8.3",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the disrupted-in-Schizophrenia 1 protein (DISC1 12d2) in 25 mM Tris-HCl, 150 mM NaCl, 1mM DTT, pH 7.4 were collected on the EMBL P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 1M-W detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123987 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.80 mg/ml was measured at 20°C. 20 successive 0.095 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 17.31,
"experimental_mw_error": null,
"guinier_i0_mw": 17.31,
"guinier_i0_mw_error": null,
"porod_mw": 24.1,
"porod_mw_error": null,
"pddf_i0": 444.6,
"pddf_i0_error": null,
"guinier_i0": 461.76,
"guinier_i0_error": 1.15,
"pddf_rg": 2.512,
"pddf_rg_error": null,
"guinier_rg": 2.64,
"guinier_rg_error": 0.1,
"pddf_dmax": 7.26,
"pddf_dmax_error": null,
"porod_volume": 40.9,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 14,
"guinier_point_last": 168,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDK7_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:18.120449+02:00",
"bragg_peak": []
}
