Calbindin-D28K

{
  "code": "SASDDM6",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The X-ray structure of human calbindin-D28K: an improved model.",
    "publication": {
      "title": "The X-ray structure of human calbindin-D28K: an improved model.",
      "author_list": "Noble JW, Almalki R, Roe SM, Wagner A, Duman R, Atack JR",
      "journal": "Acta Crystallogr D Struct Biol",
      "doi": "10.1107/S2059798318011610",
      "pmid": "30289411",
      "published_date": "2018 Oct 1"
    },
    "status": "released",
    "submitted_date": "2018-05-17",
    "released_date": "2018-10-04"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDDM6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDM6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDM6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDM6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDDM6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDM6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDM6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Calbindin",
          "short_name": "CALB1",
          "sequence": "GPHMAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN",
          "organism": "Homo sapiens",
          "uniprot_code": "P05937",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT\nFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET\nEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK\nFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA\nLSDGGKLYRTDLALILCAGDN",
          "mw": 30.316,
          "total_mw": 30.316,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Calbindin-D28K",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Brighton, UK",
            "full_name": "University of Sussex",
            "webpage": "http://www.sussex.ac.uk/"
          }
        ],
        "contributor_name": "James",
        "contributor_surname": "Noble",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-02-28",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 3.0,
    "number_of_frames": 14,
    "wavelength": 0.1,
    "sample_detector_distance": 4.0,
    "concentration_min": null,
    "concentration_max": 12.2,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.037,
    "s_max": 3.696,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDDM6_fit1_model1_img.png",
          "software": "DAMMIF",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "dammif",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDDM6_fit1_model1.pdb",
          "model_mw": 27.6,
          "bead_radius": 2.5,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 280
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDDM6_fit1_fit_img.png",
      "software": "DAMMIF",
      "chi_square_value": 1.156,
      "p_value": 0.172169,
      "fit_residual_plot": "SASDDM6_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDDM6_fit1.fir",
      "fit_log": null,
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.5a",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of calbindin-D28K in 20 mM Tris, 150mM NaCl, pH 7.8, were collected on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 4 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 12.20 mg/ml was measured at 25°C. 14 successive 3 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 25.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 29.0,
  "porod_mw_error": null,
  "pddf_i0": 0.08571,
  "pddf_i0_error": null,
  "guinier_i0": 0.08563,
  "guinier_i0_error": 0.0001,
  "pddf_rg": 2.14,
  "pddf_rg_error": null,
  "guinier_rg": 2.142,
  "guinier_rg_error": 0.005,
  "pddf_dmax": 6.95,
  "pddf_dmax_error": null,
  "porod_volume": 46.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 38,
  "guinier_point_last": 259,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDDM6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDDM6",
  "status": "success",
  "started_at": "2026-08-11T15:12:26.890568+00:00",
  "finished_at": "2026-08-11T15:12:35.102850+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDM6/",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasddm6/source/summary.json",
      "size": 7197,
      "sha256": "9b2dc267ce08260913c5d320d666ef1e6375d2ebc4652a9d1991470fb5b67b3d"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDDM6.dat",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasddm6/source/SASDDM6.dat",
      "size": 65756,
      "sha256": "a9606ae3d0e55d083e8b93a94cf2144d4676e91273b7e5539dc66aca2c07916b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDDM6.out",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasddm6/source/SASDDM6.out",
      "size": 33921,
      "sha256": "abda1d919350c1eefaa8a207aef37646caeb75fd1f096e879b50002165d91f50",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDM6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasddm6/source/SASDDM6.sascif",
      "size": 198506,
      "sha256": "28360e304fe2777d0ae02d3f1a12ad37b34d82550f5565c67e09d4bcbf0edc3f",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDDM6.zip",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasddm6/source/SASDDM6.zip",
      "size": 41341,
      "sha256": "3a163553d0156a7f940249382e21719a2cd3e9bc2b76dc2546cf96530bb2a2af",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}