The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDDT8",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.",
"publication": {
"title": "Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.",
"author_list": "Roed NK, Viola CM, Kristensen O, Schluckebier G, Norrman M, Sajid W, Wade JD, Andersen AS, Kristensen C, Ganderton TR, Turkenburg JP, De Meyts P, Brzozowski AM",
"journal": "Nat Commun",
"doi": "10.1038/s41467-018-06192-3",
"pmid": "30242155",
"published_date": "2018 Sep 21"
},
"status": "released",
"submitted_date": "2018-06-21",
"released_date": "2018-12-03"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDT8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDT8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDT8_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDT8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDT8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "ID14-3",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Insulin-like peptide 5",
"short_name": null,
"sequence": "NSLRACGPALMDMLRVACPNGFNSMFAK\r\nGVVDSCCRKSCSFSTLRAYCDS",
"organism": "Drosophila melanogaster",
"uniprot_code": "E7BBS4",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYE\nDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS",
"mw": 5.385,
"total_mw": 5.385,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Neural/ectodermal development factor IMP-L2",
"short_name": "Imp-L2 IBP",
"sequence": "MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKF\r\nTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVR\r\nVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTE\r\nKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMG\r\nNYKCIARNVVGKDTADTFVYPVLNEED",
"organism": "Drosophila melanogaster",
"uniprot_code": "Q09024",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKF\nTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVR\nVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTE\nKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMG\nNYKCIARNVVGKDTADTFVYPVLNEED",
"mw": 29.895,
"total_mw": 29.895,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "phosphate buffered saline",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Neural/ectodermal development factor IMP-L2 in complex with insulin-like peptide 5 (DILP5)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Denmark",
"full_name": "Novo Nordisk A/S",
"webpage": "https://www.novonordisk.com/"
}
],
"contributor_name": "Mathias",
"contributor_surname": "Norrman",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2011-11-20",
"storage_temperature": 5.0,
"cell_temperature": 25.0,
"exposure_time": 10.0,
"number_of_frames": 10,
"wavelength": 0.093,
"sample_detector_distance": 2.43,
"concentration_min": 2.3,
"concentration_max": 9.3,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.064,
"s_max": 6.108,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of neural/ectodermal development factor IMP-L2 in complex with insulin-like peptide 5 (DILP5) in phosphate buffered saline, pH 7.4 were collected on the ID14-3 beam line at the ESRF storage ring (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.4 m and at a wavelength of λ = 0.093 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 2.3 and 9.3 mg/ml were measured at 25°C. 10 successive 10 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 30.0,
"experimental_mw_error": null,
"guinier_i0_mw": 30.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 44.77,
"guinier_i0_error": 0.03,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 2.59,
"guinier_rg_error": 0.04,
"pddf_dmax": 9.0,
"pddf_dmax_error": null,
"porod_volume": 55.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 26,
"guinier_point_last": 65,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDT8_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDDT8",
"status": "success",
"started_at": "2026-08-11T16:00:11.279148+00:00",
"finished_at": "2026-08-11T16:00:18.090106+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDDT8/",
"path": "/data/saxsdb/sasbdb/entries/t8/sasddt8/source/summary.json",
"size": 7432,
"sha256": "991bc907b94a0145174204a57ad3177e68ef314f8a42c301c30f0df54049f806"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDDT8.dat",
"path": "/data/saxsdb/sasbdb/entries/t8/sasddt8/source/SASDDT8.dat",
"size": 58038,
"sha256": "5a8d094c85edd1e4a3b331772f88606e6eec01af443bae9e90d9f60637c7eeaa",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/t8/sasddt8/source/SASDDT8.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDT8.sascif",
"path": "/data/saxsdb/sasbdb/entries/t8/sasddt8/source/SASDDT8.sascif",
"size": 74868,
"sha256": "d1c9e9ddcf1069569e458588f65135f59728439ae290bf0581a86dd812381e3d",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDDT8.zip",
"path": "/data/saxsdb/sasbdb/entries/t8/sasddt8/source/SASDDT8.zip",
"size": 15599,
"sha256": "68cabac27ca67109a98e1239f3f5999c110f9229ca286d6d2d7c5981f5200f1f",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
