This data set displays SAXS data measured from the liquid egg white from a raw chicken egg. The most abundant protein in the egg white is ovalbumin, but there are other proteins present. Because this is a measurement of intact biological tissue, there is no experimental buffer per se to subtract, and accordingly, raw data without buffer subtraction are reported here. Because the protein concentration is relatively high (~ 170 mg/ml), the parameters Rg and monomer molecular weight may not apply here. The sample measurement (1 x 1800 s exposure) was performed at 10°C. Measurements used a rotating-anode system with Cu Kα radiation (λ = 0.1542 nm) from a Bruker-Nonius FR591 generator operated at 3.4 kW. Collimation was performed using circular pinholes and Osmic Max-Flux confocal optics. The scattered X-rays (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle) were collected using a Bruker Hi-Star area detector. Data were collected at sample−detector distances of 54 and 150 cm, and the data merged to create a single profile over the range q ∈ [0.08, 3.5] nm−1. To minimize background, an integral vacuum with a pressure of < 0.3 mbar was maintained along the entire flight path.
相关论文
标题
The Proof Is in the <i>Pidan</i>: Generalizing Proteins as Patchy Particles.
This data set displays SAXS data measured from the liquid egg white from a raw chicken egg. The most abundant protein in the egg white is ovalbumin, but there are other proteins present. Because this is a measurement of intact biological tissue, there is no experimental buffer per se to subtract, and accordingly, raw data without buffer subtraction are reported here. Because the protein concentration is relatively high (~ 170 mg/ml), the parameters Rg and monomer molecular weight may not apply here. The sample measurement (1 x 1800 s exposure) was performed at 10°C. Measurements used a rotating-anode system with Cu Kα radiation (λ = 0.1542 nm) from a Bruker-Nonius FR591 generator operated at 3.4 kW. Collimation was performed using circular pinholes and Osmic Max-Flux confocal optics. The scattered X-rays (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle) were collected using a Bruker Hi-Star area detector. Data were collected at sample−detector distances of 54 and 150 cm, and the data merged to create a single profile over the range q ∈ [0.08, 3.5] nm−1. To minimize background, an integral vacuum with a pressure of < 0.3 mbar was maintained along the entire flight path.
{
"code": "SASDDX8",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "The Proof Is in the <i>Pidan</i>: Generalizing Proteins as Patchy Particles.",
"publication": {
"title": "The Proof Is in the <i>Pidan</i>: Generalizing Proteins as Patchy Particles.",
"author_list": "Cai J, Sweeney AM",
"journal": "ACS Cent Sci",
"doi": "10.1021/acscentsci.8b00187",
"pmid": "30062112",
"published_date": "2018 Jul 25"
},
"status": "released",
"submitted_date": "2018-06-23",
"released_date": "2018-07-20"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDDX8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX8_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDDX8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDDX8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "multiwire",
"name": "Bruker HI-STAR",
"resolution": 0.0
},
"name": "University of Pennslyvania",
"city": "Philadelphia, PA",
"country": "USA",
"beamline_name": "Bruker Nonius FR591",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Ovalbumin",
"short_name": "Ova",
"sequence": "GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNV\r\nHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRN\r\nVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTM\r\nSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAE\r\nSLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP",
"organism": "Gallus gallus",
"uniprot_code": "P01012",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRF\nDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQ\nCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIV\nFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTM\nSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMA\nMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFR\nADHPFLFCIKHIATNAVLFFGRCVSP",
"mw": 42.75,
"total_mw": 42.75,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "Water",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Raw chicken egg albumen",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "Penn",
"address": "Philadelphia, PA, United States",
"full_name": "University of Pennsylvania",
"webpage": "http://www.upenn.edu/"
}
],
"contributor_name": "Jing",
"contributor_surname": "Cai",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-06-27",
"storage_temperature": 4.0,
"cell_temperature": 10.0,
"exposure_time": 1800.0,
"number_of_frames": 1,
"wavelength": 0.1542,
"sample_detector_distance": 1.5,
"concentration_min": null,
"concentration_max": 170.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.08,
"s_max": 3.28,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "This data set displays SAXS data measured from the liquid egg white from a raw chicken egg. The most abundant protein in the egg white is ovalbumin, but there are other proteins present. Because this is a measurement of intact biological tissue, there is no experimental buffer per se to subtract, and accordingly, raw data without buffer subtraction are reported here. Because the protein concentration is relatively high (~ 170 mg/ml), the parameters Rg and monomer molecular weight may not apply here. The sample measurement (1 x 1800 s exposure) was performed at 10°C. Measurements used a rotating-anode system with Cu Kα radiation (λ = 0.1542 nm) from a Bruker-Nonius FR591 generator operated at 3.4 kW. Collimation was performed using circular pinholes and Osmic Max-Flux confocal optics. The scattered X-rays (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle) were collected using a Bruker Hi-Star area detector. Data were collected at sample−detector distances of 54 and 150 cm, and the data merged to create a single profile over the range q ∈ [0.08, 3.5] nm−1. To minimize background, an integral vacuum with a pressure of < 0.3 mbar was maintained along the entire flight path.",
"tags": [
"softmatter"
],
"intensity_unit": "arbitrary",
"experimental_mw": 43.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 1.32,
"guinier_i0_error": null,
"pddf_rg": 2.0,
"pddf_rg_error": null,
"guinier_rg": null,
"guinier_rg_error": null,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDDX8_datloglog_img.png",
"symmetry": null,
"last_modified": "2022-01-27T08:15:01.824559+01:00",
"bragg_peak": []
}
