Gamma-crystallin S monomer

{
  "code": "SASDE27",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The structure and stability of the disulfide-linked γS-crystallin dimer provide insight into oxidation products associated with lens cataract formation.",
    "publication": {
      "title": "The structure and stability of the disulfide-linked γS-crystallin dimer provide insight into oxidation products associated with lens cataract formation.",
      "author_list": "Thorn DC, Grosas AB, Mabbitt PD, Ray NJ, Jackson CJ, Carver JA",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2018.12.005",
      "pmid": "30552875",
      "published_date": "2018 Dec 12"
    },
    "status": "released",
    "submitted_date": "2018-10-29",
    "released_date": "2018-12-18"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE27.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE27.txt",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE27_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE27_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE27_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE27_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE27.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "multiwire",
        "name": "Bruker HI-STAR",
        "resolution": 0.0
      },
      "name": "Australian Nuclear Science and Technology Organisation/Australian Centre for Neutron Scattering",
      "city": "Sydney",
      "country": "Australia",
      "beamline_name": "Bruker Nanostar II",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Gamma-crystallin S",
          "short_name": null,
          "sequence": ">sp|P22914|CRYGS_HUMAN Gamma-crystallin S OS=Homo sapiens OX=9606 GN=CRYGS PE=1 SV=4\r\nMSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMY\r\nILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIME\r\nQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE",
          "organism": "Homo sapiens",
          "uniprot_code": "P22914",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMY\nILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIME\nQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE",
          "mw": 21.007,
          "total_mw": 21.007,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM sodium phosphate",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Gamma-crystallin S monomer",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Canberra, Australia",
            "full_name": "Australian National University",
            "webpage": "https://www.anu.edu.au/"
          }
        ],
        "contributor_name": "Aidan",
        "contributor_surname": "Grosas",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-02-23",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 3600.0,
    "number_of_frames": 4,
    "wavelength": 0.1541,
    "sample_detector_distance": 0.73,
    "concentration_min": null,
    "concentration_max": 3.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.128,
    "s_max": 3.91,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE27_fit1_model1_img.png",
          "software": "Chimera",
          "pdb_link": [
            {
              "pdb_code": "2m3t",
              "ext_code": "2M3T",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDE27_fit1_model1.pdb",
          "model_mw": 20.93,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 383
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/2m3t-101_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.425,
      "p_value": 0.229414,
      "fit_residual_plot": "fit4columns1875_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDE27_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.6",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of gamma-crystallin S monomer in 20 mM sodium phosphate, pH 7 were collected on the Bruker Nanostar II instrument at the Australian Nuclear Science and Technology Organisation/Australian Centre for Neutron Scattering (ANSTO/ACNS, Sydney, Australia) using a multiwire Bruker Hi-Star detector at a sample-detector distance of 0.7 m and at a wavelength of λ = 0.1541 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 25°C. Four successive 3600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 15.8,
  "experimental_mw_error": null,
  "guinier_i0_mw": 15.8,
  "guinier_i0_mw_error": 3.3,
  "porod_mw": 17.0,
  "porod_mw_error": null,
  "pddf_i0": 133.5,
  "pddf_i0_error": 0.5,
  "guinier_i0": 131.69,
  "guinier_i0_error": 1.0,
  "pddf_rg": 1.85,
  "pddf_rg_error": null,
  "guinier_rg": 1.796,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 5.9,
  "pddf_dmax_error": null,
  "porod_volume": 27.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 65,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDE27_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDE27",
  "status": "success",
  "started_at": "2026-08-11T15:20:13.279894+00:00",
  "finished_at": "2026-08-11T15:20:21.483240+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE27/",
      "path": "/data/saxsdb/sasbdb/entries/27/sasde27/source/summary.json",
      "size": 7736,
      "sha256": "67a2b0a9a93f76823b4d229a7c334196f725191e8a0b9ecb5fe42d631fa4a952"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDE27.txt",
      "path": "/data/saxsdb/sasbdb/entries/27/sasde27/source/SASDE27.dat",
      "size": 27257,
      "sha256": "27b7555edd001bb470622bf26b0ae18793158f6409b876ec9b10625d06230f78",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDE27.out",
      "path": "/data/saxsdb/sasbdb/entries/27/sasde27/source/SASDE27.out",
      "size": 26662,
      "sha256": "2d9417cdc578392afe792359673800d877a3d6708d1984fb9193d4b05501fc64",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE27.sascif",
      "path": "/data/saxsdb/sasbdb/entries/27/sasde27/source/SASDE27.sascif",
      "size": 382101,
      "sha256": "65e41a336fe5527641f5c967d86a60278132b4d927129fca2e34355d1386b704",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDE27.zip",
      "path": "/data/saxsdb/sasbdb/entries/27/sasde27/source/SASDE27.zip",
      "size": 78864,
      "sha256": "bddc02f985f743c6a168346b01680c77cbebea45043df1a8335a438a10982a4c",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}