Toxin GraT

{
  "code": "SASDE48",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.",
    "publication": {
      "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.",
      "author_list": "Talavera A, Tamman H, Ainelo A, Konijnenberg A, Hadži S, Sobott F, Garcia-Pino A, Hõrak R, Loris R",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-019-08865-z",
      "pmid": "30814507",
      "published_date": "2019 Feb 27"
    },
    "status": "released",
    "submitted_date": "2018-11-15",
    "released_date": "2019-03-04"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE48.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE48.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE48_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE48_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE48_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE48_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE48.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Putative killer protein, Toxin GraT.",
          "short_name": "GraT",
          "sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYENLYFQ",
          "organism": "Pseudomonas putida",
          "uniprot_code": "Q88MI5",
          "uniprot_range_first": 1,
          "uniprot_range_last": 91,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNR\nADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYH",
          "mw": 11.104,
          "total_mw": 11.104,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM Tris 250 mM NaCl 2 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Toxin GraT",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "VUB",
            "address": "Pleinlaan 2 1050 Brussel ",
            "full_name": "Vrije Universiteit Brussel",
            "webpage": "http://www.vub.ac.be/"
          }
        ],
        "contributor_name": "Ariel",
        "contributor_surname": "Talavera",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-09-21",
    "storage_temperature": 24.8,
    "cell_temperature": 25.0,
    "exposure_time": 0.99,
    "number_of_frames": 40,
    "wavelength": 0.103317,
    "sample_detector_distance": 1.499,
    "concentration_min": null,
    "concentration_max": 12.5,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.146,
    "s_max": 6.642,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Toxin GraT in 50 mM Tris 250 mM NaCl 2 mM TCEP, pH 8 were collected using using size exclusion chromatography SAXS (SEC-SAXS) on the SWING beam line at SOLEIL (Saint-Aubin, France) using a Eiger 4M detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.103317 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 25°C using the following parameters: Column: Shodex KW402.5-4F; Flow rate: 0.2 mL/min; Total acquisition time: 17 min; Sample injection concentration: 12.5 mg/mL; Injection volume: 40 μL. 40 successive 0.990 second frames were collected through the SEC elution profile. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 11.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.0143,
  "pddf_i0_error": 2e-05,
  "guinier_i0": 0.01421,
  "guinier_i0_error": 1.5e-05,
  "pddf_rg": 1.55,
  "pddf_rg_error": 0.3,
  "guinier_rg": 1.509,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 5.47,
  "pddf_dmax_error": null,
  "porod_volume": 18.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 38,
  "guinier_point_last": 122,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDE48_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDE48",
  "status": "success",
  "started_at": "2026-08-11T15:45:27.715310+00:00",
  "finished_at": "2026-08-11T15:45:36.743951+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE48/",
      "path": "/data/saxsdb/sasbdb/entries/48/sasde48/source/summary.json",
      "size": 6326,
      "sha256": "4cad3d51d540aba8cd756583104939b5519ed297fd797e53ead0ad8d1887a109"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDE48.dat",
      "path": "/data/saxsdb/sasbdb/entries/48/sasde48/source/SASDE48.dat",
      "size": 52438,
      "sha256": "2f08244947e4d7c55b9a9c28fd960ed7e1caefd6629e83961b6f1021a06542af",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDE48.out",
      "path": "/data/saxsdb/sasbdb/entries/48/sasde48/source/SASDE48.out",
      "size": 75736,
      "sha256": "215e52e400dffa433a94af33d84b83c7f1943dd4bac9c58e6c63f8c23c0782d2",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE48.sascif",
      "path": "/data/saxsdb/sasbdb/entries/48/sasde48/source/SASDE48.sascif",
      "size": 108831,
      "sha256": "e7a76cd4f486f6d391ada0d2db6dac0be269f3d11aaf0d4a21b7c32bd9e058d2",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDE48.zip",
      "path": "/data/saxsdb/sasbdb/entries/48/sasde48/source/SASDE48.zip",
      "size": 36594,
      "sha256": "72eebbaa8ebb704ba693c4e80e44cb6fa8941eea75553383bf503b627194207a",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}