The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDE58",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.",
"publication": {
"title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.",
"author_list": "Talavera A, Tamman H, Ainelo A, Konijnenberg A, Hadži S, Sobott F, Garcia-Pino A, Hõrak R, Loris R",
"journal": "Nat Commun",
"doi": "10.1038/s41467-019-08865-z",
"pmid": "30814507",
"published_date": "2019 Feb 27"
},
"status": "released",
"submitted_date": "2018-11-15",
"released_date": "2019-03-04"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE58.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE58.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE58_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE58.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Putative killer protein, Toxin GraT.",
"short_name": "GraT",
"sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYENLYFQ",
"organism": "Pseudomonas putida",
"uniprot_code": "Q88MI5",
"uniprot_range_first": 1,
"uniprot_range_last": 91,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNR\nADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYH",
"mw": 11.104,
"total_mw": 11.104,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "antitoxin GraA, antidote of toxin GraT",
"short_name": "GraA",
"sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA",
"organism": "Pseudomonas putida",
"uniprot_code": "Q88MI6",
"uniprot_range_first": 1,
"uniprot_range_last": 99,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS\nICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA",
"mw": 10.905,
"total_mw": 21.81,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Putative killer protein, Toxin GraT",
"short_name": "GraT.",
"sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYENLYFQ",
"organism": "Pseudomonas putida",
"uniprot_code": null,
"uniprot_range_first": 1,
"uniprot_range_last": 91,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 11.104,
"total_mw": 11.104,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris 250 mM NaCl 2 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Complex of toxin GraT with antotoxin GraA",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "VUB",
"address": "Pleinlaan 2 1050 Brussel ",
"full_name": "Vrije Universiteit Brussel",
"webpage": "http://www.vub.ac.be/"
}
],
"contributor_name": "Ariel",
"contributor_surname": "Talavera",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-06-29",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.5,
"number_of_frames": 1200,
"wavelength": 0.10332,
"sample_detector_distance": 1.999,
"concentration_min": null,
"concentration_max": 10.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.064,
"s_max": 4.483,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the complex formed between toxin GraT with antotoxin GraA in 50 mM Tris 250 mM NaCl 2 mM TCEP, pH 8 were collected using size exclusion chromatography SAXS (SEC-SAXS) on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 2.0 m and at a wavelength of λ = 0.10332 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 10°C using the following parameters: Column: Shodex KW402.5-4F; Flow rate: 0.2 mL/min; Sample injection concentration: 12.5 mg/mL; Injection volume: 40 μL. 1200 successive 0.500 second frames were collected. The data measured through the SEC elution profile of the sample were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 40.991,
"experimental_mw_error": null,
"guinier_i0_mw": 40.991,
"guinier_i0_mw_error": null,
"porod_mw": 39.0,
"porod_mw_error": null,
"pddf_i0": 0.04879,
"pddf_i0_error": 1.4e-05,
"guinier_i0": 0.04886,
"guinier_i0_error": 3.1e-05,
"pddf_rg": 2.34,
"pddf_rg_error": null,
"guinier_rg": 2.349,
"guinier_rg_error": 0.05,
"pddf_dmax": 7.91,
"pddf_dmax_error": null,
"porod_volume": 63.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 17,
"guinier_point_last": 108,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDE58_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDE58",
"status": "success",
"started_at": "2026-08-11T15:46:07.183867+00:00",
"finished_at": "2026-08-11T15:46:14.804863+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE58/",
"path": "/data/saxsdb/sasbdb/entries/58/sasde58/source/summary.json",
"size": 7999,
"sha256": "d9696e3e58bf87cd6deed172c040ab0c5d245ce8c1615aca9e96058a10c86604"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDE58.dat",
"path": "/data/saxsdb/sasbdb/entries/58/sasde58/source/SASDE58.dat",
"size": 44424,
"sha256": "40f38abc360ad00aa63026f75224470a4c8d8f23c19f6202d861f2c02bf97238",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDE58.out",
"path": "/data/saxsdb/sasbdb/entries/58/sasde58/source/SASDE58.out",
"size": 67053,
"sha256": "cc4a5436d2f3136c9dd6d7362e6d821973279882261aa8004f9371b4703e476c",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE58.sascif",
"path": "/data/saxsdb/sasbdb/entries/58/sasde58/source/SASDE58.sascif",
"size": 4740,
"sha256": "b8a7ea28d144fa0fbdb79415fd61ee65444f7a97ce23bf67bbd2dfef93debdd2",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDE58.zip",
"path": "/data/saxsdb/sasbdb/entries/58/sasde58/source/SASDE58.zip",
"size": 30427,
"sha256": "d9f8adf6b0f13840a8fb3ec7110788ad86145c463d6a721267f3b90230a22bb9",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
