Calredoxin with Calcium

{
  "code": "SASDEA9",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Calcium sensing via EF-hand 4 enables thioredoxin activity in the sensor-responder protein calredoxin in the green alga <i>Chlamydomonas reinhardtii</i>.",
    "publication": {
      "title": "Calcium sensing via EF-hand 4 enables thioredoxin activity in the sensor-responder protein calredoxin in the green alga <i>Chlamydomonas reinhardtii</i>.",
      "author_list": "Charoenwattanasatien R, Zinzius K, Scholz M, Wicke S, Tanaka H, Brandenburg JS, Marchetti GM, Ikegami T, Matsumoto T, Oda T, Sato M, Hippler M, Kurisu G",
      "journal": "J Biol Chem",
      "doi": "10.1074/jbc.RA119.008735",
      "pmid": "31776187",
      "published_date": "2019 Nov 27"
    },
    "status": "released",
    "submitted_date": "2018-12-27",
    "released_date": "2019-12-17"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEA9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEA9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEA9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEA9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "Structural Biology Laboratory, Graduate School of Medical Life Science, Yokohama City University",
      "city": "Yokohama",
      "country": "Japan",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Calredoxin, Redox protein from Chlamydomonas reinhardtii",
          "short_name": "CRX",
          "sequence": "MCSARSVRVVPRAATFEGLMDDASKAKMEELERRFKMADVDGNGHIDREELRNLLESMESGEVYMMSQHWLPEDELERCMEQYDVNKDGVISFEEFKQIIYDGLLLEGTLAEYESAFKAVDKSGNGTIGATELSKLFASLGNPVSLEKLVDLMQMYDKDDSGQIEFPEFLLMFRNSLLDLKDMTTYMTLDEAGAGSSGSLVDAVEGDMTLIFSEEELDALISANPDKLVVVFGALTWCRPCKGMQRPVQKLAEHYKDHIVFVKLFGNANKQTKRIFKERFQIRSTPCFITLRKGEPVYTQTGSNKEKLEAGLRSLIANPPVGMIYPSAEALAALQDPNSSSVDKLAAALEHHHHHH",
          "organism": "Chlamydomonas reinhardtii",
          "uniprot_code": "A0A2K3DZB3",
          "uniprot_range_first": 25,
          "uniprot_range_last": 357,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MIAIRTAHMLSGAQRAGSGTRVPRCSARSVRVVPRAATFEGLMDDASKAKMEELERRFKM\nADVDGNGHIDREELRNLLESMESGEVYMMSQHWLPEDELERCMEQYDVNKDGVISFEEFK\nQIIYDGLLLEGTLAEYESAFKAVDKSGNGTIGATELSKLFASLGNPVSLEKLVDLMQMYD\nKDDSGQIEFPEFLLMFRNSLLDLKDMTTYMTLDEAGAGSSGSLVDAVEGDMTLIFSEEEL\nDALISANPDKLVVVFGALTWCRPCKGMQRPVQKLAEHYKDHIVFVKLFGNANKQTKRIFK\nERFQIRSTPCFITLRKGEPVYTQTGSNKEKLEAGLRSLIANPPVGMIYPSAEALAAL",
          "mw": 39.901,
          "total_mw": 39.901,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl, 1 mM DTT, 5 mM CaCl2",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Calredoxin with Calcium",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Thailand",
            "full_name": "Synchrotron Light Research Institute",
            "webpage": "https://www.slri.or.th"
          }
        ],
        "contributor_name": "Ratana",
        "contributor_surname": "Charoenwattanasatien",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-11-17",
    "storage_temperature": null,
    "cell_temperature": 20.0,
    "exposure_time": 120.0,
    "number_of_frames": 2,
    "wavelength": 0.15418,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.033,
    "s_max": 6.681,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of Calredoxin with Calcium in 20 mM Tris, 150 mM NaCl, 1 mM DTT, 5 mM CaCl2, pH 8 were collected on a Rigaku BioSAXS-1000 instrument at the Structural Biology Laboratory, Graduate School of Medical Life Science, Yokohama City University (Yokohama, Japan) using a Pilatus 100K detector at a wavelength of λ = 0.15418 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 20°C. Two successive 120 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 42.05,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 42.0,
  "porod_mw_error": null,
  "pddf_i0": 0.7076,
  "pddf_i0_error": null,
  "guinier_i0": 0.7,
  "guinier_i0_error": 0.003,
  "pddf_rg": 3.19,
  "pddf_rg_error": null,
  "guinier_rg": 3.06,
  "guinier_rg_error": 0.08,
  "pddf_dmax": 11.56,
  "pddf_dmax_error": null,
  "porod_volume": 68.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 16,
  "guinier_point_last": 58,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDEA9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-17T19:23:05.878669+01:00",
  "bragg_peak": []
}

{
  "code": "SASDEA9",
  "status": "success",
  "started_at": "2026-08-11T16:09:40.459883+00:00",
  "finished_at": "2026-08-11T16:09:48.265804+00:00",
  "source_last_modified": "2019-12-17T19:23:05.878669+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEA9/",
      "path": "/data/saxsdb/sasbdb/entries/a9/sasdea9/source/summary.json",
      "size": 6917,
      "sha256": "29c536ebdb8a6b24be00d2e1cb03bd095382552b2dcffafd55002c50355c1725"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDEA9.dat",
      "path": "/data/saxsdb/sasbdb/entries/a9/sasdea9/source/SASDEA9.dat",
      "size": 30585,
      "sha256": "059d2c7df0dfc66a10c256a5e82e71479fdaee101fb98146b4b679835182aad0",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDEA9.out",
      "path": "/data/saxsdb/sasbdb/entries/a9/sasdea9/source/SASDEA9.out",
      "size": 37941,
      "sha256": "551110b84ce82c1508ebf3e5765bc4f4cd3c5be2965356a8cb471053199408de",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEA9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/a9/sasdea9/source/SASDEA9.sascif",
      "size": 85177,
      "sha256": "3bd4f870b4e58767cbfae958e8f50c2eb6d550e4305c4ef3ec28d8fe70a6ce85",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDEA9.zip",
      "path": "/data/saxsdb/sasbdb/entries/a9/sasdea9/source/SASDEA9.zip",
      "size": 21463,
      "sha256": "af81a6fd149e8370ca7297e75ce629066c9fe1a694afcc2532229d1dac219467",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}