The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDEG2",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/nm",
"project": {
"title": "Structural Basis of Membrane Protein Chaperoning through the Mitochondrial Intermembrane Space.",
"publication": {
"title": "Structural Basis of Membrane Protein Chaperoning through the Mitochondrial Intermembrane Space.",
"author_list": "Weinhäupl K, Lindau C, Hessel A, Wang Y, Schütze C, Jores T, Melchionda L, Schönfisch B, Kalbacher H, Bersch B, Rapaport D, Brennich M, Lindorff-Larsen K, Wiedemann N, Schanda P",
"journal": "Cell",
"doi": "10.1016/j.cell.2018.10.039",
"pmid": "30445040",
"published_date": "2018 Nov 15"
},
"status": "released",
"submitted_date": "2018-08-13",
"released_date": "2018-11-21"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEG2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEG2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEG2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEG2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEG2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEG2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEG2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Mitochondrial import inner membrane translocase subunit TIM9",
"short_name": "TIM9",
"sequence": "MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSE RVGQRFQEQNAALGQGLGR",
"organism": "Saccharomyces cerevisiae",
"uniprot_code": "O74700",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCS\nEKFLKHSERVGQRFQEQNAALGQGLGR",
"mw": 10.202,
"total_mw": 61.212,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Mitochondrial import inner membrane translocase subunit TIM10",
"short_name": "TIM10",
"sequence": "GSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF",
"organism": "Saccharomyces cerevisiae",
"uniprot_code": "P87108",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS\nCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF",
"mw": 10.23,
"total_mw": 61.38,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Mitochondrial GTP/GDP carrier protein 1",
"short_name": "GGC1",
"sequence": "QSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGASSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSKLEHHHHHH",
"organism": "Saccharomyces cerevisiae",
"uniprot_code": "P38988",
"uniprot_range_first": 8,
"uniprot_range_last": 300,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF\nSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM\nRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR\nNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN\nRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK",
"mw": 33.426,
"total_mw": 33.426,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50mM Tris, 150mM NaCl, imidiazole",
"concentration_unit": null,
"comment": "The imidiazole concentration varies between 200 mM and 300 mM",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Mitochondrial import inner membrane translocase complex TIM9·10 in complex with a precursor (GDP/GTP carrier (Ggc1))",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL",
"address": "Grenoble, France",
"full_name": "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation",
"webpage": "https://www.embl.fr/"
}
],
"contributor_name": "Martha",
"contributor_surname": "Brennich",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-02-22",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 50,
"wavelength": 0.099,
"sample_detector_distance": 2.872,
"concentration_min": 0.0,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.17,
"s_max": 4.945,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "r5575",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit1_model1.pdb",
"model_mw": 138.0,
"bead_radius": 3.4,
"log": null,
"symmetry": "C1",
"comment": null,
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDEG2_fit1_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.358,
"p_value": 4.5e-05,
"fit_residual_plot": "SASDEG2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEG2_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dammif29.log",
"software_version": "r5575",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit2_model1.pdb",
"model_mw": 153.2,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDEG2_fit2_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.89,
"p_value": 0.0,
"fit_residual_plot": "SASDEG2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEG2_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model1_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model1.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model2_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model2.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model3_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model3.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model4_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model4.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model5_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model5.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model6_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model6.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model7_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model7.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEG2_fit3_model8_img.png",
"software": "GROMACS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEG2_fit3_model8.pdb",
"model_mw": 156.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Snapshot from a 7ns coarse-grained simulation. Fit corresponds to weighte ensemble, based on 16 runs",
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDEG2_fit3_fit_img.png",
"software": "Other",
"chi_square_value": 6.1178,
"p_value": 0.0,
"fit_residual_plot": "SASDEG2_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEG2_fit3.FIT",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the mitochondrial import inner membrane translocase complex (TIM9·10) in complex with a precursor (GDP/GTP carrier (Ggc1)) in 50mM Tris, 150mM NaCl, imidiazole, pH 7.4 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Data was collected directly on the eluent from an Ni-NTA affinity chromatography column to ensure the isolation of a stable, non-aggregated complex. A solute concentration of approximately 2.00 mg/ml was measured at 20°C. 50 successive 1 second frames were collected through the elution peak. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 160.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 160.0,
"porod_mw_error": null,
"pddf_i0": 13.97,
"pddf_i0_error": null,
"guinier_i0": 13.9,
"guinier_i0_error": 0.0095,
"pddf_rg": 4.601,
"pddf_rg_error": null,
"guinier_rg": 4.51,
"guinier_rg_error": 0.03,
"pddf_dmax": 16.0,
"pddf_dmax_error": null,
"porod_volume": 272.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 17,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEG2_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
