Protein tyrosine phosphatase SHP2 with E76K activating mutation

{
  "code": "SASDEP4",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/A",
  "project": {
    "title": "Mechanism of activating mutations and allosteric drug inhibition of the phosphatase SHP2.",
    "publication": {
      "title": "Mechanism of activating mutations and allosteric drug inhibition of the phosphatase SHP2.",
      "author_list": "Pádua RAP, Sun Y, Marko I, Pitsawong W, Stiller JB, Otten R, Kern D",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-018-06814-w",
      "pmid": "30375376",
      "published_date": "2018 Oct 30"
    },
    "status": "released",
    "submitted_date": "2018-09-14",
    "released_date": "2018-11-05"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEP4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEP4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEP4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEP4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEP4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEP4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEP4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Rayonix MX225-HE",
        "resolution": null
      },
      "name": "Stanford Synchrotron Radiation Lightsource (SSRL)",
      "city": "Menlo Park, CA",
      "country": "USA",
      "beamline_name": "BL4-2",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Tyrosine-protein phosphatase non-receptor type 11 E76K",
          "short_name": "SHP2 E76K",
          "sequence": "GSGMTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG\r\nDYYDLYGGEKFATLAKLVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK\r\nEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD\r\nVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT\r\nDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP\r\nVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV\r\nERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF\r\nRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR\r\nEKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRI",
          "organism": "Homo sapiens",
          "uniprot_code": "Q06124",
          "uniprot_range_first": 1,
          "uniprot_range_last": 529,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG\nDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK\nEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD\nVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT\nDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP\nVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV\nERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF\nRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR\nEKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH\nEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR",
          "mw": 60.911,
          "total_mw": 60.911,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM ADA, 2 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Protein tyrosine phosphatase SHP2 with E76K activating mutation",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Chevy Chase, USA",
            "full_name": "Howard Hughes Medical Institute, Department of Biochemistry, Brandeis University",
            "webpage": "https://www.hhmi.org/"
          }
        ],
        "contributor_name": "RIcardo",
        "contributor_surname": "Padua",
        "orcid": "https://orcid.org/0000-0001-9719-3440"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-03-28",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 10,
    "wavelength": 0.1127,
    "sample_detector_distance": 1.65,
    "concentration_min": 0.76,
    "concentration_max": 12.2,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.141,
    "s_max": 3.5,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEP4_fit1_model1_img.png",
          "software": "AllosMod",
          "pdb_link": [
            {
              "pdb_code": "6cmq",
              "ext_code": "6CMQ",
              "ext_type": "pdb",
              "difference_with_model": "derived"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDEP4_fit1_model1.pdb",
          "model_mw": 60.91,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 367
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/multi_state_model_88pdb_fitfoxs_img.png",
      "software": "MultiFoXS",
      "chi_square_value": 2.535761,
      "p_value": 0.0,
      "fit_residual_plot": "multi_state_model_88pdb_fitfoxsresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEP4_fit1.dat",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Protein tyrosine phosphatase SHP2 with E76K activating mutation in 50 mM ADA, 2 mM TCEP, pH 6.5 were collected on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL; Stanford, CA, USA) using a Rayonix MX225-HE detector at a sample-detector distance of 1.7 m and at a wavelength of λ = 0.1127 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.8 and 12.2 mg/ml were measured at 20°C. 10 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 53.15,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 143.3,
  "pddf_i0_error": null,
  "guinier_i0": 142.7,
  "guinier_i0_error": 0.44,
  "pddf_rg": 2.95,
  "pddf_rg_error": null,
  "guinier_rg": 2.91,
  "guinier_rg_error": 0.062,
  "pddf_dmax": 9.53,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 2,
  "guinier_point_last": 34,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDEP4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDEP4",
  "status": "success",
  "started_at": "2026-08-11T14:28:02.047392+00:00",
  "finished_at": "2026-08-11T14:28:10.544630+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEP4/",
      "path": "/data/saxsdb/sasbdb/entries/p4/sasdep4/source/summary.json",
      "size": 8591,
      "sha256": "f9d1645d43cff1d11110c9467031c3b290b69f30d4ddc9213ee9b6b758aef387"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDEP4.dat",
      "path": "/data/saxsdb/sasbdb/entries/p4/sasdep4/source/SASDEP4.dat",
      "size": 15818,
      "sha256": "0490a0cb23342469eeef6887ea7953c1765f49ae13ee4f97160ebf6fb1ddb012",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDEP4.out",
      "path": "/data/saxsdb/sasbdb/entries/p4/sasdep4/source/SASDEP4.out",
      "size": 30072,
      "sha256": "f19f6788203a9f05ac7c665caa05ffeb5e64eb78823718d64fbf348a54069d43",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEP4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/p4/sasdep4/source/SASDEP4.sascif",
      "size": 504064,
      "sha256": "20e8c504379bb4c06a00c8e0875df5eac1451614d64c3c3845445a838a20a5d8",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDEP4.zip",
      "path": "/data/saxsdb/sasbdb/entries/p4/sasdep4/source/SASDEP4.zip",
      "size": 102529,
      "sha256": "d0db7b8e4bad8ee60d122b3fdc3180eb478b415b732d317a3d19cd8fba303cd5",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}