The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.dat",
"role": "curve",
"sha256": "b527de569e15bb4596ede05c098c666c09ffd7cdd9fff1281b33a37e8cee4264",
"size": 46761,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEQ7.dat"
} full_entry_zip：source record and ZIP contents (4 items) {
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.zip",
"role": "full_entry_zip",
"sha256": "717b27496f477a0ef146b181e845a01fa67b7b6c917ece02ea0011e3a6118b34",
"size": 89684,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEQ7.zip",
"zip_member_count": 4,
"zip_members": [
{
"crc32": "d91f29ca",
"name": "SASDEQ7/experimental_data/SASDEQ7.dat",
"size": 46761
},
{
"crc32": "1ed5be27",
"name": "SASDEQ7/pddf/SASDEQ7.out",
"size": 33078
},
{
"crc32": "d3737f02",
"name": "SASDEQ7/SASDEQ7_fit1.fit",
"size": 45873
},
{
"crc32": "3290bfca",
"name": "SASDEQ7/SASDEQ7_fit1_model1.pdb",
"size": 229277
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.out",
"role": "pddf",
"sha256": "22f48fcabb264d33f5706f4ba272f5d29956e15436bb5986c7cc742ca4fa83bd",
"size": 33078,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDEQ7.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.sascif",
"role": "sascif",
"sha256": "732c0565df759baf0ddbfdc8265a352dd4d7e223b4a5f75af144a8eb8b9fb0f0",
"size": 358309,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEQ7.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/summary.json",
"sha256": "8d6d2627c1c6cec38da6e5515fef3a792dcc36477efc1524ca87dacff9b9e40e",
"size": 10381,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEQ7/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：159 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDEQ7",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Non-syndromic Mitral Valve Dysplasia Mutation Changes the Force Resilience and Interaction of Human Filamin A.",
"publication": {
"title": "Non-syndromic Mitral Valve Dysplasia Mutation Changes the Force Resilience and Interaction of Human Filamin A.",
"author_list": "Haataja TJK, Bernardi RC, Lecointe S, Capoulade R, Merot J, Pentikäinen U",
"journal": "Structure",
"doi": "10.1016/j.str.2018.09.007",
"pmid": "30344108",
"published_date": "2018 Oct 9"
},
"status": "released",
"submitted_date": "2018-11-12",
"released_date": "2018-11-12"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEQ7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEQ7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEQ7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEQ7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEQ7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEQ7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEQ7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Filamin A Ig-like domains 3-5",
"short_name": "FLNa3-5",
"sequence": ">FLNa3-5\r\nCNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAG",
"organism": "Homo sapiens",
"uniprot_code": "P21333",
"uniprot_range_first": 478,
"uniprot_range_last": 766,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV\nSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK\nLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL\nPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ\nVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK\nRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF\nAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI\nQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP\nSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF\nEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE\nAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM\nADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE\nALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA\nKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP\nRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK\nAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP\nFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV\nEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG\nSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF\nADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE\nAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC\nYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE\nYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET\nRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV\nPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV\nDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV\nPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI\nKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG\nKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA\nLAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK\nKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV\nDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC\nSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL\nSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS\nQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG\nTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC\nDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH\nVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK\nAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL\nQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY\nLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG\nALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR\nLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV\nDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS\nPYRVVVP",
"mw": 30.76,
"total_mw": 30.76,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 100 mM NaCl, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Filamin A Ig-like domains 3-5 (FLNa3-5)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Jyväskylän, Finland",
"full_name": "University of Jyväskylä",
"webpage": "https://www.jyu.fi"
}
],
"contributor_name": "Tatu",
"contributor_surname": "Haataja",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-02-10",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 10,
"wavelength": 0.1,
"sample_detector_distance": 2.9,
"concentration_min": 1.0,
"concentration_max": 4.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.06,
"s_max": 4.937,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEQ7_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "4m9p",
"ext_code": "4M9P",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEQ7_fit1_model1.pdb",
"model_mw": 30.74,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 251
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/FLNa35_crysol_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.001,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1920_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEQ7_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": "SAXS data describing the Filamin A Ig-like domains 3-5 in solution. The experiment was done to enable comparison with the corresponding P637Q mutated fragment (SASDEP7).",
"experiment_description": "Synchrotron SAXS data from solutions of Filamin A Ig-like domains 3-5 in 20 mM Tris, 100 mM NaCl, 1 mM DTT, pH 8 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1 and 4 mg/ml were measured at 20°C. 10 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 24.7,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 25.64,
"pddf_i0_error": null,
"guinier_i0": 25.64,
"guinier_i0_error": 0.1,
"pddf_rg": 2.2,
"pddf_rg_error": null,
"guinier_rg": 2.19,
"guinier_rg_error": 0.1,
"pddf_dmax": 7.34,
"pddf_dmax_error": 0.5,
"porod_volume": 39.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 8,
"guinier_point_last": 114,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEQ7_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDEQ7",
"status": "success",
"started_at": "2026-08-11T16:27:12.174165+00:00",
"finished_at": "2026-08-11T16:27:20.697810+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEQ7/",
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/summary.json",
"size": 10381,
"sha256": "8d6d2627c1c6cec38da6e5515fef3a792dcc36477efc1524ca87dacff9b9e40e"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEQ7.dat",
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.dat",
"size": 46761,
"sha256": "b527de569e15bb4596ede05c098c666c09ffd7cdd9fff1281b33a37e8cee4264",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDEQ7.out",
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.out",
"size": 33078,
"sha256": "22f48fcabb264d33f5706f4ba272f5d29956e15436bb5986c7cc742ca4fa83bd",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEQ7.sascif",
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.sascif",
"size": 358309,
"sha256": "732c0565df759baf0ddbfdc8265a352dd4d7e223b4a5f75af144a8eb8b9fb0f0",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEQ7.zip",
"path": "/data/saxsdb/sasbdb/entries/q7/sasdeq7/source/SASDEQ7.zip",
"size": 89684,
"sha256": "717b27496f477a0ef146b181e845a01fa67b7b6c917ece02ea0011e3a6118b34",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
} 
