Cytohesin-2; ARF nucleotide-binding site opener, ARNO

{
  "code": "SASDEW9",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.",
    "publication": {
      "title": "Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.",
      "author_list": "Das S, Malaby AW, Nawrotek A, Zhang W, Zeghouf M, Maslen S, Skehel M, Chakravarthy S, Irving TC, Bilsel O, Cherfils J, Lambright DG",
      "journal": "Structure",
      "doi": "10.1016/j.str.2019.09.007",
      "pmid": "31601460",
      "published_date": "2019 Oct 5"
    },
    "status": "released",
    "submitted_date": "2019-01-17",
    "released_date": "2019-10-14"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEW9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEW9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEW9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEW9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEW9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEW9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEW9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Cytohesin-2 ARF nucleotide-binding site opener",
          "short_name": "ARNO",
          "sequence": "MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRK\r\nKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNL\r\nVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGL\r\nERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRR\r\nWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGN\r\nHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP",
          "organism": "Homo sapiens",
          "uniprot_code": "Q99418",
          "uniprot_range_first": 1,
          "uniprot_range_last": 400,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ\nRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE\nLNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ\nSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN\nEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP\nRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT\nQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP",
          "mw": 46.6,
          "total_mw": 93.2,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "300 mM NaCl, 2 mM 2-mercaptoethanol and 30 mM Tris-HCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Cytohesin-2; ARF nucleotide-binding site opener, ARNO",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Cachan, France",
            "full_name": "CNRS UMR8113, ENS Paris-Saclay",
            "webpage": "http://lbpa.ens-paris-saclay.fr/"
          }
        ],
        "contributor_name": "Wenhua",
        "contributor_surname": "Zhang",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-06-23",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 1.0,
    "number_of_frames": 1500,
    "wavelength": 0.993,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.072,
    "s_max": 4.952,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEW9_fit1_model1_img.png",
          "software": "GASBOR",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDEW9_fit1_model1.pdb",
          "model_mw": null,
          "bead_radius": 1.9,
          "log": "https://www.sasbdb.org/media/log_files/GS-4_1.log",
          "symmetry": null,
          "comment": null,
          "user": 84
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/GS-4_1_fit_img.png",
      "software": "GASBOR",
      "chi_square_value": 1.45,
      "p_value": 0.0,
      "fit_residual_plot": "GS-4_1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEW9_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/GS-4_1.log",
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the cytohesin-2; ARF nucleotide-binding site opener, ARNO, in 300 mM NaCl, 2 mM 2-mercaptoethanol and 30 mM Tris-HCl, pH 7.5 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Dectris Pilatus 1M detector at a wavelength of λ = 0.993 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 10.00 mg/ml was measured at 15°C. 1500 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 94.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 90.0,
  "porod_mw_error": null,
  "pddf_i0": 44.95,
  "pddf_i0_error": null,
  "guinier_i0": 43.99,
  "guinier_i0_error": 0.067,
  "pddf_rg": 5.107,
  "pddf_rg_error": null,
  "guinier_rg": 4.75,
  "guinier_rg_error": 0.1,
  "pddf_dmax": 19.65,
  "pddf_dmax_error": null,
  "porod_volume": 145.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 5,
  "guinier_point_last": 43,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDEW9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDEW9",
  "status": "success",
  "started_at": "2026-08-11T16:23:09.628261+00:00",
  "finished_at": "2026-08-11T16:23:18.326247+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEW9/",
      "path": "/data/saxsdb/sasbdb/entries/w9/sasdew9/source/summary.json",
      "size": 7912,
      "sha256": "b78308ed1b975f81f427ada69f10f2e3dbe900917362b3c5959e478eae81ad08"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDEW9.dat",
      "path": "/data/saxsdb/sasbdb/entries/w9/sasdew9/source/SASDEW9.dat",
      "size": 47675,
      "sha256": "f6fda651f37485b7be37c116e87f36706732ee2f8a2dc4c94f1ae4fc79fe71ac",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDEW9.out",
      "path": "/data/saxsdb/sasbdb/entries/w9/sasdew9/source/SASDEW9.out",
      "size": 49283,
      "sha256": "2b73b3be6cab6fe66914f62639e984971cabafb7c016c1f9aa67e61caa3c3cf6",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEW9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/w9/sasdew9/source/SASDEW9.sascif",
      "size": 262721,
      "sha256": "afdf65898cb3c4d50480c41d621a409501e505b39116806bf3e4e49fc0abfa64",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDEW9.zip",
      "path": "/data/saxsdb/sasbdb/entries/w9/sasdew9/source/SASDEW9.zip",
      "size": 57038,
      "sha256": "25d2476792920ba85a6448a6a810fa28f7337e2a5617e66a93e2906c8a58c4d5",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}