Delta subunit of RNA polymerase, RNAP (B. subtilis), 10mM NaCl

{
  "code": "SASDF58",
  "status": "Published",
  "type_of_curve": "Extrapolated to infinite dilution",
  "angular_unit": "1/nm",
  "project": {
    "title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
    "publication": {
      "title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
      "author_list": "Kuban V, Srb P, Stegnerova H, Padrta P, Zachrdla M, Jasenakova Z, Šanderová H, Vítovská D, Krasny L, Koval T, Dohnalek J, Ziemska-Legi Cka J, Grynberg M, Jarnot P, Gruca A, Jensen MR, Blackledge M, Zidek L",
      "journal": "J Am Chem Soc",
      "doi": "10.1021/jacs.9b07837",
      "pmid": "31550880",
      "published_date": "2019 Sep 24"
    },
    "status": "released",
    "submitted_date": "2019-06-22",
    "released_date": "2019-09-30"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF58.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF58_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF58_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF58_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF58.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "DNA-directed RNA polymerase subunit delta",
          "short_name": "RpoE",
          "sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
          "organism": "Bacillus subtilis",
          "uniprot_code": "P12464",
          "uniprot_range_first": 1,
          "uniprot_range_last": 173,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT\nDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE\nDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
          "mw": 20.399,
          "total_mw": 20.399,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Phosphate buffer, 10 mM NaCl, 0.05% NaN3",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.6,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Delta subunit of RNA polymerase, RNAP (B. subtilis), 10mM NaCl",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "MUNI",
            "address": "Brno, Czech Republic",
            "full_name": "Masaryk University;   \tResearch group Structure and Dynamics of Proteins.",
            "webpage": "https://www.muni.cz/"
          }
        ],
        "contributor_name": "Vojtěch",
        "contributor_surname": "Kubáň",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-10-03",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.05,
    "number_of_frames": 20,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": 0.9,
    "concentration_max": 3.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.013,
    "s_max": 3.79,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "There is a concentration effect for the delta subunit of RNA polymerase in a low salt concentration buffer.",
  "experiment_description": "Synchrotron SAXS data from solutions of RNAP in 20 mM phosphate buffer, 10 mM NaCl, 0.05% NaN3, pH 6.6 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.9 and 3.6 mg/ml were measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentrations were extrapolated to infinite dilution and merged with the higher concentration data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 28.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 23.0,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 6172.0,
  "guinier_i0_error": 26.0,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 3.45,
  "guinier_rg_error": 0.3,
  "pddf_dmax": 14.0,
  "pddf_dmax_error": null,
  "porod_volume": 38.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 19,
  "guinier_point_last": 174,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDF58_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDF58",
  "status": "success",
  "started_at": "2026-08-11T15:46:08.130393+00:00",
  "finished_at": "2026-08-11T15:46:14.423911+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF58/",
      "path": "/data/saxsdb/sasbdb/entries/58/sasdf58/source/summary.json",
      "size": 6721,
      "sha256": "6ee5f6fc80a5ae4741f8169b395b82649d07187293b20429e2244301b5606b90"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDF58.dat",
      "path": "/data/saxsdb/sasbdb/entries/58/sasdf58/source/SASDF58.dat",
      "size": 81982,
      "sha256": "38a5d0cda6289474ef4843988f4db867de0fd2efde3df2617be71f5cf43aa4f8",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/58/sasdf58/source/SASDF58.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF58.sascif",
      "path": "/data/saxsdb/sasbdb/entries/58/sasdf58/source/SASDF58.sascif",
      "size": 105541,
      "sha256": "4a3cc882aedbd82061bf6317283b83d771ba1f70b5aa089f58b2aa5eddd8633c",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDF58.zip",
      "path": "/data/saxsdb/sasbdb/entries/58/sasdf58/source/SASDF58.zip",
      "size": 23092,
      "sha256": "a7b27c4d51d9e719be0f2fb5aff9b6561338b3239216ff15ce3d6842be736e87",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}